KEGG   Kitasatospora albolonga: B7C62_25340Help
Entry
B7C62_25340       CDS       T05009                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
kab  Kitasatospora albolonga
Brite
KEGG Orthology (KO) [BR:kab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B7C62_25340
Enzymes [BR:kab01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B7C62_25340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: ARF75199
UniProt: A0A1V0VCP3
LinkDB All DBs
Position
complement(5687585..5687980)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDADFRTRAVLIKEQ
RAELAKHHVSVLWSDYFKPPHFEKHPELHQLINDTLKALSAAKGSNDPATGQKALDLIAE
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtgaaggtcagcgcccactgcgacctgccctgc
ggcgtctacgacccggcccaggcccgtatcgaggccgagtcggtcaaggccgtccaggag
aagtaccaggccaacgaggacgcggacttccgcacccgcgcggtcctgatcaaggaacag
cgcgccgagctcgcgaagcaccacgtctcggtgctctggagcgactacttcaagcccccg
cacttcgagaagcacccggagctgcaccagctgatcaacgacaccctgaaggcgctctcc
gcggccaagggctcgaacgacccggcgacgggccagaaggccctggacctgatcgccgag
atcgacaagatcttctgggagaccaagaaggcttga

DBGET integrated database retrieval system