KEGG   Kitasatospora albolonga: B7C62_25425Help
Entry
B7C62_25425       CDS       T05009                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
kab  Kitasatospora albolonga
Pathway
kab00020  Citrate cycle (TCA cycle)
kab00310  Lysine degradation
kab00380  Tryptophan metabolism
kab01100  Metabolic pathways
kab01110  Biosynthesis of secondary metabolites
kab01120  Microbial metabolism in diverse environments
kab01130  Biosynthesis of antibiotics
kab01200  Carbon metabolism
Module
kab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B7C62_25425
  09105 Amino acid metabolism
   00310 Lysine degradation
    B7C62_25425
   00380 Tryptophan metabolism
    B7C62_25425
Enzymes [BR:kab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     B7C62_25425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ARF75215
UniProt: A0A1V0VCR1
LinkDB All DBs
Position
complement(5701961..5705788)
Genome map
AA seq 1275 aa AA seqDB search
MSSQSPSNSSISTDQASPGTNPAAAFGANEWLVDEIYQQYLQDPSSVDRAWWDFFADYKP
GTSGAADKPVPGAAASGAAADGAPAATAPAQPAAPVKPAAAPAQAKTETKPAEAKAAPAP
APAKPAPAKPAAAPAKAEAKADAKASEATEAPAGPEYVTLRGPSAAVAKNMNASLELPTA
TSVRAVPVKLLFDNRIVINNHLKRARGGKISFTHLIGYAMVQALKAMPSMNYSFAVKDGK
PTLVKPEHVNLGLAIDLVKPNGDRQLVVAAIKKAETLNFFEFWQAYEDIVRRARIGKLGM
DDFTGVTASLTNPGGIGTVHSVPRLMPGQGLIMGVGAMDYPAEFQGTSQDTLNKLGISKV
MTLTSTYDHRVIQGAASGEFLRVLSQLLLGQNDFYDEIFKALRIPYEPVRWLTDIDASHD
NDVTKAARVFELIHSYRVRGHVMADTDPLEYRQRKHPDLDITEHGLTLWDLERDFAVGGF
AGKSMMKLRDILGVLRESYCRTTGIEFMHIQDPKQRKWLQDRVERPRAQQPEREEQLRIL
RRLNAAEAFETFLQTKYVGQKRFSLEGGESVIPLLDAVIDSAAEARLDEVVIGMAHRGRL
NVLANIVGKSYAQIFREFEGNLDPRSMHGSGDVKYHLGAEGTFTGLDGEQIKVSLAANPS
HLEAVDPVLEGIARAKQDIINKGGTDFTVLPVALHGDAAFAGQGVVAETLNMSQLRGYRT
GGTVHVVINNQVGFTAAPESSRSSMYATDVARMIEAPIIHVNGDDPEAVVRVARLAFEFR
QAFNKDVVIDLICYRRRGHNEGDNPEFTNPQMYTLIDKKRSVRKLYTESLIGRGDITLEE
AEQALQDFQGQLEKVFAEVREATSQPAAPHVPEPQAAFPVAVDTAVSAEIVKRIAESQVN
IPESITVHPRLMPQMQRRAASVENGTIDWGMGETLAIGSLLMEGTPVRLAGQDSRRGTFG
QRHAVLVDQVTGEDYTPLLYLTEDQARYNVYDSLLSEYAAMGFEYGYSLARPESLVIWEA
QFGDFVNGAQTVVDEFISSAEQKWGQTSGVTLLLPHGYEGQGPDHSSARPERFLQMCAQD
NMTVAMPTLPSNYFHLLRWQVHNPHHKPLIVFTPKSMLRLKAAASKIEEFTSGGFRPVIG
DDSVKAEDVRKVVFVSGKLFYDLDAEREKRGDTETALIRLERLYPLPGAEIQAEIAKYPN
AEKYLWAQEEPANQGAWPFIALNLIDHLDLAVGADVPHGERLRRISRPHGSSPAVGSAKR
HQAEQTQLVNEVFEA
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtctcagtcccccagtaactcgagcatctcgaccgaccaagccagcccgggcacc
aacccggccgccgctttcggcgccaatgagtggctcgtcgacgagatctaccagcagtac
ctccaggaccccagttcggtcgatcgcgcctggtgggacttcttcgccgactacaagccg
ggtacctccggcgcggcggacaagcccgttcccggcgccgcagcctcgggggctgcggcg
gacggggccccggccgccaccgccccggcgcagcccgcggccccggtgaagcccgccgcg
gccccggcgcaggcgaagaccgaaacgaagcccgcggaggccaaggccgccccggccccg
gcccccgcgaagcccgccccggccaagcccgccgccgcgcccgcgaaggccgaggccaag
gcggacgccaaggcgtccgaggccaccgaggccccggccggtcccgagtacgtgacgctg
cgcggcccctccgccgccgtcgcgaagaacatgaacgcctcgctggagctgccgacggcc
acgtccgtccgcgcggtcccggtgaagctgctcttcgacaaccgcatcgtcatcaacaac
cacctcaagcgcgcccggggcgggaagatctccttcacgcacctcatcgggtacgcgatg
gtgcaggccctcaaggccatgccgtcgatgaactactccttcgcggtgaaggacggcaag
ccgaccctggtcaagccggagcacgtcaacctcggtctcgccatcgacctggtgaagccg
aacggtgaccgccagctggtcgtcgcggccatcaagaaggccgagacgctcaacttcttc
gagttctggcaggcgtacgaggacatcgtccggcgcgcccgcatcggcaagctcggcatg
gacgacttcaccggcgtcaccgcctcgctgaccaaccccggcggcatcggcaccgtccac
tcggtgccccgcctgatgcccggacagggcctcatcatgggcgtcggcgcgatggactac
ccggcggagttccagggcacctcccaggacaccctgaacaagctcggcatctcgaaggtc
atgacgctcacgtcgacctacgaccaccgggtcatccagggcgcggcctccggtgagttc
ctgcgcgtcctgagccagctgctgctgggccagaacgacttctacgacgagatcttcaag
gccctgcgcatcccgtacgagccggtccgctggctcacggacatcgacgcgtcgcacgac
aacgacgtgacgaaggccgcacgggtcttcgagctgatccactcctaccgggtccggggc
cacgtcatggccgacaccgacccgctggagtaccgccagcgcaagcaccccgacctcgac
atcaccgagcacggcctcaccctgtgggacctggagcgggacttcgcggtcggcgggttc
gcgggcaagtcgatgatgaagctccgcgacatcctcggtgtgctgcgtgagtcgtactgc
cgcaccaccggcatcgagttcatgcacatccaggacccgaagcagcgcaagtggctccag
gaccgggtggagcggccccgcgcccagcagcccgagcgcgaggagcagctgcgcatcctg
cggcggctgaacgcggccgaggcgttcgagaccttcctccagaccaagtacgtcggccag
aagcggttctcgctggagggcggcgagtccgtcatcccgctgctcgacgcggtcatcgac
tccgccgccgaggcccgcctcgacgaggtcgtcatcggcatggcccaccgcggccgcctg
aacgtcctggcgaacatcgtcggcaagtcgtacgcgcagatcttccgcgagttcgagggc
aacctcgacccgcgctcgatgcacggctccggcgacgtcaagtaccacctgggcgccgag
ggcaccttcaccggtctggacggcgagcagatcaaggtctcgctggccgccaacccctcg
cacctggaggcggtcgacccggtcctggagggcatcgcccgcgccaagcaggacatcatc
aacaagggcggcacggacttcacggtcctgccggtcgcgctccacggcgacgcggccttt
gcgggccagggcgtcgtcgccgagacgctcaacatgtcgcagctgcgcggctaccgcacc
ggcggcaccgtgcacgtggtgatcaacaaccaggtcggcttcaccgccgccccggagtcc
tcgcgctcctcgatgtacgccaccgacgtggcgcgcatgatcgaggcgccgatcatccac
gtcaacggtgacgacccggaggccgtggtccgcgtcgcgcggctcgccttcgagttccgg
caggcgttcaacaaggacgtcgtgatcgacctcatctgctaccgccgccgcggtcacaac
gagggcgacaacccggagttcaccaacccgcagatgtacaccctgatcgacaagaagcgc
tcggtgcgcaagctctacaccgagtccctcatcggtcgcggcgacatcacgctggaagag
gcggagcaggcgctccaggacttccagggtcagctggagaaggtcttcgccgaggtccgc
gaggccacctcgcagccggccgccccgcacgtcccggagccgcaggccgcgttcccggtg
gccgtggacacggcggtctccgcggagatcgtcaagcggatcgccgagtcccaggtcaac
atccccgagtcgatcaccgtccacccccgtctgatgccgcagatgcagcgtcgcgcggcc
tcggtggagaacggcacgatcgactggggcatgggcgagaccctggccatcggttcgctg
ctgatggagggcaccccggtccggctcgcgggccaggacagccgccgcggcacgttcggc
cagcgccacgcggtcctggtggaccaggtcaccggcgaggactacaccccgctgctgtac
ctcaccgaggaccaggcccgctacaacgtctacgactcgctgctcagcgagtacgcggcg
atgggcttcgagtacggctactcgctggcccgcccggagtcgctggtcatctgggaggcc
cagttcggtgacttcgtcaacggcgcgcagaccgtcgtggacgagttcatctcctcggcc
gagcagaagtggggccagacctccggcgtcacgctgctgctgccgcacggctacgagggc
cagggcccggaccacagctccgctcgcccggagcgcttcctccagatgtgcgcgcaggac
aacatgacggtcgcgatgccgaccctcccctcgaactacttccacctgctgcgctggcag
gtgcacaacccgcaccacaagccgctcatcgtcttcaccccgaagtcgatgctgcgtctg
aaggcggcggcgtcgaagatcgaggagttcaccagcggcggcttccgtccggtgatcggt
gacgacagcgtcaaggcggaggacgtccgcaaggtcgtcttcgtctcgggcaagctcttc
tacgacctggacgccgagcgggagaagcgcggcgacacggagaccgcgctcatccggctg
gagcggctgtacccgctgccgggtgcggagatccaggccgagatcgccaagtacccgaac
gccgagaagtacctctgggcccaggaggagccggccaaccagggtgcgtggccgttcatc
gcgctcaacctgatcgaccacctggacctggccgtcggcgcggacgtgccgcacggcgag
cgcctgcgccgcatctcgcgtccgcacggctcgtccccggcggtcggctcggccaagcgc
caccaggccgagcagacgcagctggtcaacgaggtcttcgaagcctga

DBGET integrated database retrieval system