KEGG   Kitasatospora albolonga: B7C62_30220Help
Entry
B7C62_30220       CDS       T05009                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
kab  Kitasatospora albolonga
Brite
KEGG Orthology (KO) [BR:kab00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    B7C62_30220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ARF76070
UniProt: A0A1V0VFU1
LinkDB All DBs
Position
6865072..6866238
Genome map
AA seq 388 aa AA seqDB search
MLYRNVSKRRMAWQLLKDTVNSCIEYRILGLAAEAAFFTLLSLPPLLLGLIGLLGYVDEW
TTTETVASIERNILSASQTVLSERGVNEFAKPLLADVTTGARPDVISIGFAIALWSGSRA
VNVFIDTITVMYGLDGHRGIVKTRLLAFLLYVVALLLGAVVLPLLVVGPDRVVEWVPWGT
EVIAVLYWPLVIVLTIAFLTTLYHVSVPVRSPWIEDVPGALVALGMWVLGSFLLRIYLTN
TVEGPTIYGSLAAPIAVLLWIGISAFAVLVGAAVNAAIDRVWPSLATAAAREATERVRAA
QAAEFVARTRPAAYDEVDDDDDEDDGQAYMPSEFPERWSRFLPPDDVKSRFQPTWEKEPK
EPKEPKEPRGPQVKEPGEPRDGSGPPPV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgctctaccgcaacgtctccaagcggcgcatggcgtggcagttgctcaaggacaccgtc
aactcgtgcatcgagtaccggattctcgggctggcggccgaggcggcgttcttcaccctg
ctgtccctgccgccgctgctgctcggactgatcgggctgctcggttacgtcgacgagtgg
acgaccaccgagacggtcgcctccatcgagcgcaacatcctctcggcctcgcagaccgtg
ctctccgagcgcggggtcaacgagttcgccaaaccgctgctcgccgacgtcaccaccggc
gcccgccccgacgtcatctccatcggcttcgccatcgccctgtggtccggctcccgcgcg
gtgaacgtcttcatcgacaccatcaccgtcatgtacggcctcgacggccaccggggcatc
gtcaagacccggctgctcgccttcctgctgtacgtggtcgccctgctgctgggcgcggtg
gtgctgccgctgctcgtcgtcggacccgaccgggtggtcgagtgggtgccctggggcacc
gaggtcatcgccgtcctctactggcccctggtcatcgtcctcacgatcgcgttcctcacg
acgctctaccacgtgtccgtcccggtgcgctcgccgtggatcgaggacgtccccggggcg
ctcgtggcgctcgggatgtgggtgctcggcagcttcctgctgcggatctacctcaccaac
acggtcgaaggccccacgatctacggctccttggcggcacccatcgccgtcctgctctgg
ataggcatctccgctttcgcggtcctggtcggcgccgcggtcaacgcggccatcgaccgg
gtctggccctcgctcgccaccgccgccgcccgcgaggccaccgaacgcgtccgggccgcg
caggccgccgagttcgtcgcccggacccgcccggccgcctacgacgaggtggacgacgac
gatgacgaggacgacggccaggcgtacatgccctcggagttcccggagcgctggtcccgc
ttcctgccgccggacgacgtcaagtcccggttccagccgacctgggagaaggagcccaag
gaaccgaaggagccgaaagaacccagaggcccccaggtcaaggagcccggagagccccgc
gacggctccggcccgccgccggtctga

DBGET integrated database retrieval system