KEGG   Kitasatospora albolonga: B7C62_30905Help
Entry
B7C62_30905       CDS       T05009                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kab  Kitasatospora albolonga
Pathway
kab00250  Alanine, aspartate and glutamate metabolism
kab00410  beta-Alanine metabolism
kab00640  Propanoate metabolism
kab00650  Butanoate metabolism
kab01100  Metabolic pathways
kab01120  Microbial metabolism in diverse environments
Module
kab_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kab00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B7C62_30905
   00650 Butanoate metabolism
    B7C62_30905
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B7C62_30905
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B7C62_30905
Enzymes [BR:kab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B7C62_30905
Amino acid related enzymes [BR:kab01007]
 Aminotransferase (transaminase)
  Class III
   B7C62_30905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ARF76194
UniProt: A0A1V0VFH4
LinkDB All DBs
Position
7016971..7018254
Genome map
AA seq 427 aa AA seqDB search
MSGLYERHLAVSPEWLALYYRHPIELTHGEGRYVWDADGNRYLDFFGGILTTMTAHALPE
VTKAVSEQAGRIIHSSTLYLNRPMVELAERIATLSGIPDARVFFTTSGTEANDTALLLAT
AYRRSNQILAMRNSYHGRSFSAVSVTGNQSWSPTSLSPLQTLYVHGGVRTRGPYAELSDA
QFIRACVADLEDLLGHTREAAALIAEPIQGVGGFTSPPDGLFAAFREVLDRHGVLWISDE
VQTGWGRTGEHFWGWQAHAENGPPDILTFAKGIGNGMSIGGVVARAEVMNCLDANSISTF
GGSPVTMAAGLANLSYALEHDLQGNARRVGGLLVERLRSIAAASDAVREVRGRGLMLGIE
LVRPGTDEANPEAAAAVLEAARAGGLLIGKGGGHSTSVLRIAPPLTLTVAEAEEGAAILA
DALQAAG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggactgtacgaacgccacctcgccgtcagccccgagtggctggccctctactac
cgccaccccatcgaactcacccacggcgagggccggtacgtctgggacgccgacggcaac
cgctacctcgacttcttcggcggcatcctcaccaccatgaccgcccacgccctgcccgag
gtcaccaaggcggtctccgagcaggccgggcggatcatccactcctccacgctctacctc
aaccgcccgatggtggagctggccgaacggatcgccaccctctccggcatccccgacgcc
cgggtcttcttcaccacatcgggcaccgaggcgaacgacaccgcgctgctgctcgccacc
gcgtaccgccggtccaaccagatcctcgcgatgcgcaacagctaccacggccgctccttc
tcggccgtctccgtcaccggcaaccagtcctggtcgcccacgagcctctccccgctccag
acgctgtacgtccacgggggcgtccgcacccggggcccgtacgcggagctgagcgacgcg
cagttcatccgggcctgcgtggccgatctggaggacctcctcgggcacacccgggaggcc
gccgcgctcatcgccgaaccgatccagggcgtcggcgggttcacctcgccgcccgacggg
ctgttcgccgcgttccgcgaagtcctggaccggcacggcgtgttgtggatctccgacgag
gtgcagaccggctggggccggaccggcgaacacttctggggctggcaggcacacgcggag
aacgggccgccggacatcctcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggggtcgtcgcccgcgcggaggtgatgaactgcctggacgccaactccatctccacgttc
ggcggttcacccgtcaccatggcggccggcctcgccaacctctcgtacgccctggaacac
gacctccagggcaacgcgcggcgcgtcggcgggctcctcgtcgagcggctgcggtcgatc
gccgccgcgtccgacgccgtacgcgaagtgcgcggccggggcctgatgctcggcatcgaa
ctggtcaggcccggtacggacgaggcgaacccggaggcggccgcggccgtcctcgaagcg
gcgcgggcgggcgggctgctcatcggcaagggcggcggccacagcaccagcgtgctgcgg
atcgccccaccgctgaccctgaccgtcgccgaggccgaggagggcgcggcgatcctcgcg
gacgccctgcaggcggcgggctga

DBGET integrated database retrieval system