KEGG   Kitasatospora albolonga: B7C62_31305Help
Entry
B7C62_31305       CDS       T05009                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kab  Kitasatospora albolonga
Pathway
kab00020  Citrate cycle (TCA cycle)
kab00480  Glutathione metabolism
kab01100  Metabolic pathways
kab01110  Biosynthesis of secondary metabolites
kab01120  Microbial metabolism in diverse environments
kab01130  Biosynthesis of antibiotics
kab01200  Carbon metabolism
kab01210  2-Oxocarboxylic acid metabolism
kab01230  Biosynthesis of amino acids
Module
kab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kab_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B7C62_31305
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B7C62_31305
Enzymes [BR:kab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B7C62_31305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: ARF76268
UniProt: A0A1V0VGC9
LinkDB All DBs
Position
7120681..7122903
Genome map
AA seq 740 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSLLPVIEAYASTAGVTVERRDISLAGRIIASFPEHLKAEQ
RIDDALAELGELARTPGANIIKLPNISASIPQLKAAIAELQGQGYALPDYPDDPRTDADK
DVRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTADSKTNVATMGADD
FRSTEKSAVIAEDGSLRIELHGDDGTTTVLRESVPVLKGEVVDAAVLRVAALREFFTAQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHAVRAFFPNTFAKYGDQLAAAGLTPNDGLGGI
LKGLDSLPGVGAEIQASFEAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSG
HMWGPDGNEADTIAVLPDSSYAGVYQVVIDDCRANGAFDPATMGSVPNVGLMAQKAEEYG
SHDKTFEIAATGTVRVVDTDGNVVLEQAVGAGDIFRMCQTKDAPIQDWVKLAVTRARATG
TPAVFWLDEGRAHDANLIAKVTTYLADHDTDGLDISIKTPEEATAFSLERIRRGEDTISV
TGNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRW
DSLGEFLALAVSFEHLATTTDNARAQVLADTLDRATGTFLNEDKSPSRRLGGIDNRGSHF
YLALYWAQELAQQTDDTKLAEAFAPLAKTLAEQEETIVAELIAVQGSPAEIGGYYQPDPA
KAEAIMRPSATFNKAIASLA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacaccgacgaggcccctgccctggcgacctat
tccctcctgcccgtgatcgaggcgtacgcctcgaccgcaggcgtcacggtggagcgccgt
gacatctccctcgcgggacggatcatcgccagtttcccggagcacctcaaggccgagcag
cgtatcgatgacgcactcgccgagctcggcgagctggccaggacgcccggcgcgaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctcaaggccgcgatcgcggagctc
caggggcagggctacgcgcttccggactacccggacgacccgcggacggacgcggacaag
gacgtgcgcgcccggtacgacaaggtcaagggcagcgccgtgaacccggtgctgcgcgag
ggcaactccgaccgccgcgcccccgcctccgtcaagaactacgccaaggcccacccgcac
cgcatgggcgcctggacggccgactcgaagacgaacgtcgccaccatgggcgccgacgac
ttccgctccaccgagaagtccgcggtcatcgccgaggacggctcgctccggatcgagctg
cacggcgacgacggcaccaccaccgtgctccgcgagtccgtacccgtcctcaagggcgag
gtcgtggacgcggccgtcctgcgcgtcgccgcgctgcgcgagttcttcaccgcgcaggtc
gcccgcgccaaggccgagggcgtgctcttctccgtgcacctcaaggccaccatgatgaag
gtctccgacccgatcatcttcggccacgcggtccgcgccttcttcccgaacaccttcgcc
aagtacggcgaccagctcgccgccgccggcctcacccccaacgacggcctgggcggcatc
ctcaagggcctggactccctgccgggcgtcggcgccgagatccaggcgtccttcgaggcc
gagctcgccgagggccccgccctcgcgatggtcgactccgacaagggcatcaccaacctg
cacgtccccagcgacgtcatcgtggacgcctccatgcccgccatgatccgcacttcgggc
cacatgtggggcccggacggcaacgaggccgacaccatcgccgtcctcccggacagcagc
tacgccggtgtctaccaggtcgtcatcgacgactgccgcgccaacggcgccttcgacccc
gccaccatgggctcggtgcccaacgtcggtctgatggcgcagaaggccgaggagtacggc
agccacgacaagaccttcgagatcgccgccaccggcaccgtccgcgttgtcgacacggac
ggcaacgtcgtgctggagcaggccgtcggcgccggtgacatcttccggatgtgccagacc
aaggacgccccgatccaggactgggtcaagctcgccgtcacccgcgcccgcgccaccggc
accccggccgtcttctggctggacgagggccgcgcgcacgacgccaacctgatcgccaag
gtcaccacgtacctcgccgaccacgacaccgacggcctggacatctcgatcaagaccccg
gaagaggccaccgccttctccctggagcgcatccgccgcggcgaggacaccatctccgtc
accggcaacgtgctccgtgactacctgacggacctcttcccgatcctggagctgggcacc
agcgccaagatgctctccgtcgtcccgctgatgaacggcggcggcctcttcgagaccggc
gcgggcggctcggcccccaagcacgtccagcagctcgtcaaggagaactacctccgctgg
gacagcctgggtgagttcctggccctcgcggtcagcttcgagcacctggccaccaccacg
gacaacgcgcgggcccaggtcctcgccgacaccctggaccgcgccacgggcaccttcctc
aacgaggacaagtccccgagccgccgcctcggtggcatcgacaaccgcggcagccacttc
tacctggccctctactgggcccaggagctggcgcagcagaccgacgacaccaagctcgcc
gaggcgttcgcgccgctcgccaagaccctggccgagcaggaggagaccatcgtcgccgag
ctgatcgcggtgcagggctccccggccgagatcggcggctactaccagcccgacccggcc
aaggccgaggcgatcatgcgcccgtccgccacgttcaacaaggcgatcgcgagcctcgcc
tga

DBGET integrated database retrieval system