KEGG   Kitasatospora albolonga: B7C62_32395Help
Entry
B7C62_32395       CDS       T05009                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
kab  Kitasatospora albolonga
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ARF76465
UniProt: A0A1V0VG82
LinkDB All DBs
Position
complement(7367197..7368258)
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMSYEAKWDGFRAIVYRDGDEVELGSRTGKSLTRYFPD
LVDAVRENLPPRCVLDGEIVIAHEGRLDFDRLSERIHPADSRVRMLAERAPASFVAFDIL
AVDDTSLLSTPQTDRRAVLTAALSGASAPVILAPSTTDIELAREWFDRYEGAGLDGIVAK
PLDLPYRPDTRAMYKIKHERTADVVVAGYREHKSGPVVGSLLLGLYDSGGVLQHVGVCAA
FPMKRRAELAEELAPLRCDFADHPWGAWAEAAAHESSRLPGTQNRWTGKKDQSWVPLRPE
RVCEVAYDHMEGDRFRHTTQFRRWRPDRTPAGCTYAQLEEVVSYDLAEVLAGG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgccgcccgtgaagccgatgctcgccaagtcggtggccaagatc
ccgccgggcatgagttacgaggcgaagtgggacggcttccgggcgatcgtctaccgggac
ggcgacgaggtcgagctcggcagccgtacgggcaagtcgctgacccgctacttcccggat
ctggtcgacgccgtacgggagaacctcccgccgcgctgtgtgctcgacggggagatcgtc
atcgcccacgaggggcggctcgacttcgaccggctcagcgagcgcatccatccggccgac
tcccgggtgcggatgctcgccgagcgggccccggcgagcttcgtcgccttcgacatcctc
gcggtggacgacacctctctgctgagcaccccgcagaccgaccggcgggcggtgctgacg
gccgccctctccggcgcctccgcgcccgtgatcctcgctccgtccaccaccgacatcgag
ctggcccgggagtggttcgaccggtacgagggggcggggctcgacgggatcgtggccaag
ccgctggacctgccgtaccggcccgacacccgggcgatgtacaagatcaagcacgagcgg
accgccgatgtcgtggtggccgggtaccgcgagcacaagagcggcccggtcgtcggctcg
ctcctgctgggcctgtacgactccgggggcgtactccagcacgtcggggtctgcgcggcc
ttcccgatgaagcggcgcgccgagctggccgaggaactcgccccgctgcgctgtgacttc
gccgaccatccgtggggggcgtgggcggaggcggcggcgcacgagagctcccggctgccg
ggtacgcagaaccgctggacggggaagaaggaccagtcgtgggtgccgctgcggccggag
cgggtctgcgaggtggcgtacgaccacatggagggcgaccggttccgccatacgacgcag
ttccggcggtggcgcccggaccggaccccggccggctgtacgtacgcgcagttggaggag
gtcgtctcctacgacctggcggaggtgctggcgggcggctga

DBGET integrated database retrieval system