KEGG   Kitasatospora albolonga: B7C62_33080Help
Entry
B7C62_33080       CDS       T05009                                 

Definition
(GenBank) polyketide synthase
Organism
kab  Kitasatospora albolonga
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short adh_short_C2 PKS_DE Thiolase_N Epimerase Docking Polysacc_synt_2 SAT RmlD_sub_bind GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: ARF76578
UniProt: A0A1V0VH93
LinkDB All DBs
Position
7593412..7604007
Genome map
AA seq 3531 aa AA seqDB search
MREYLNRVTIDLRNTRQRLREAEARTSEPIAIVSMACRFPGGVRTPEDLWDLLAEGRDTV
AAVPGDRGWETVWPSGGTVPGQGAFLDGAADFDPEFFGISPREAVAMDPQQRLLLMASWE
AVEQAGIDPITLRGSRTGVYAAAIDQGYATLGPGAAEAVQGFLMTGNSMSVMSGRVSYAL
GLEGPAVTVDTACSASLVALHLAARALRAGECSLALAGGVSVMALPAVFVEFSRQGAMSP
DGRCKPFAAAADGTGWGEGVGMLLLERLSDARRNGRTVLAVLRGSAINQDGASNGLTAPN
GPSQQRVIRAALADAGLTASEVDAVEAHGTGTTLGDPIEADALLATYGQDRSAEQPLWLG
SLKSNIGHTQAAAGVAGVIKTVLALRHGVLPRTLHVDAPTPHADWSSGAVELLTEARDWP
AVDRPRRAGVSSFGMSGTNAHVVLEQAPEPEPAEQAPGPAEQAPESEPADGSGAVTDAPE
ARTDGPSVEPDPAGPPGAALPWVLSGRTASALGDQAARLRARFATDASVRSADIGFSLAT
TRSAFEHRAVVIGDGHHALLNGLATLSGPGGDLHLPVGLAADSAAPAPAVGRASDAASAD
IVTGTGRVVEGRTALVFPGQGSQWDGMARDLLATSPAFRDRLAACDAALSAHVDWRLPAV
LEGAPGAPSLERVDVVQPVLWAVMVSLAAHWESWGVRPDAVVGHSQGEIAAAVVAGALSL
EDGAKVVALRSRAIRALAGLGGMVAVPLPEDEVRAAIAPWAEKLSVAAVNGPAAVVVSGE
PGALAELLAHCAARGVRARSVPVDYASHSAQVERIRSEVLVALDGVRPLPARTPLFSTVT
GDRLDTTAMDADYWYRNLRGTVRFDAAVRSLVEQGHEVFVEVSPHPVLTMALQDTAEATG
GAEPPVVVGTLRRDDGGPRRALRAAAELWVAGVAVDWSAVYAGSGARPTALPGYPFQLRR
YWLEPETAPGTGPAAADPHDTAFWHMVDHDDPAEIAARLAVDEDALTPVLPALRGWREQR
RDESVIDSWRYRIGWQPLPDPQAATPAAGTWLVVLPAGDDDTRVRGPLLALAEAGATVVT
AELTADAVRRTDLADTLATALGGLVPTGVLSLLATADRPHPDHPALPTGTALTVALVQAL
GDLGLTAPLWCATTGAVSTGPDDPVTHPRQALVWGTGLVAALELSARWGGLIDLPPELDA
RARTRLAAVLTASVPGPDGVGREDQLALRPTGILARRLRRAPRSDSRTNRTNRTNRWKPR
GTVLLTGGTGAVGPHLARWLARSGATHLVLPGRRGPQAPGAAELAAELAALGVRLTLPVC
DLSDRQAVAELLTGLETAGDPVTAVVHAAAFVALAPLDGTPMSAFEQIVAAKAAGAEHLD
ALLDRELDAFVLFSSIAGVWGSGDHGAYAAANAYLGALAQHRRARGLTATTLDWGIWQAE
NPWQDRVAGEDADLFNLEQHGLPRIAPDLAVQALCQALDDDETVLTVADVDWERFAAVFT
STRPSPLLTGIPEARRALEAATGDTEAPAAALLRQRLAALAESEQHRLLLDLVRTHAAAV
LGHATADAIRPGKAFQDMGFASLTAVELRNRLNAATGLRLPSTLIFDHPSSTALAQEIRA
ELLGRQTTDPHLPEPDSSVPDRSVPDSSVPDRSVPDSSVPDRSVPGAAAHLSAPADEPIA
IVSMACRFPGGIGTPEELWRLLADGGDAVSDLPTDRGWDIEALYDPDPDHPGTSTTRRGG
FLHDAADFDAEFFGISPREALAMDPQQRLLLETTWEAIERAAIDPDALRGSRTGVFTGVN
YADYAAVVAQSEEGDGHLLTGSAPSVVSGRVAYTLGLEGPAVTIDTACSSSLVALHLAGR
ALRGGDCSLALVGGVAVMATPGALISFSRQRGLAEDGRCKAFSDDADGMGMGEGVGVLLL
ERLSDARRNGHPVLAVVRGSAVNQDGASNGLSAPNGPSQQRVIRAALADAGLTASEVDVV
EAHGTGTTLGDPIEAQALLATYGQDRPADRPLLLGSLKSNLGHAQAASGVAGVIKTVLSM
RHGQVPRTLHVGRPSGHVDWTRGALALATEQQPWPLHGRPLRAGVSSFGLSGTNVHTILE
HAPLENDAPTAERVPLSAVPWLLSAKSPQALRSQADRLRRHLDGSPVPDPRDIGSALHAR
TAFEYRRALIGERDQLPALLGQMADDDSGAWDGGRTVDGRSVLVFPGQGSQWVGMAAELL
GESEVFAARMGECERALEPYVDWSLTEALGSERLLGRVDVVQPVLWAVMVSLAEVWRSFG
VAVDGVVGHSQGEVAAACVAGGLSLDDGARVVALRSRAVGVLAGRGGMASVPLSVDVVRE
RIAPWAGRLSVAAVNGPSSTVISGDADAVSGLVEEFTGEGVRARLIEVDYASHSSHVEEI
REQLLSDLEGITPLSGAVPFFSTVTGGWLDTKGLDAEYWYRNLRETVQFGSATETLLADG
FRFFIEASPHPVLGVAVGESAEVAGVEAAVLGTLRRQEGCLEQVLRAVGRAWERGLGVDW
AGAFPGARRVELPTYAFQRSRYWPEPAPTTAADVGSAGLDSADHPVLGAATELADTGELL
LSGRLSLRTHPWLADHAVAGTVLLPGAAFAELAVRAADEAGCHTVEELTLQTPLLIPADT
AVRLQVRVGAADTHGSRSLDLFSCREDATTPQWTAHATGVLTADAANRKPPPAPDDPGSW
PPPGAVPVSVDDLYERFHGSGYGYGPAFRGLTSAWRRGDEIFTEVRLPEDQHRSAAAFGV
HPALLDAALQGLFLRARPESGPDPDRPSAGLPFSWSGVRLYASAATALRVRLGFRPDGSV
AIDATDPNGLPVASVEALAVRPIDLDALRPGGGPESLYRVQWSAVPDTAPVGPLGPWAVL
GGRSLSPDTDSHPDLAALGAVLDGGAPSPAAVLAWCDHTPRLSSPPDAASVHTALDDALR
LVQEWLADPRWDDGTRLVLVTRGAVSTAAGEEVTDLTGAAVRGLVRSAQSEHPDRFLLID
TDDPAAVTGLLPRALAATEPQLAIRTGQLLAARLTRATVTTNPNPGTHALADPNPGTDAH
LRTGVLTDPDSASAPGTPSRIAVPGGTVLVTGAGGALGGLVARHLVTAHGVRNLLLVGRR
GAGAPGLADLAADLRGLGARVDVAACDVADRDALAALLDGIPADRPLSAVVHAAGVLDDG
TVESLTPARMRHVLRPKVDAALHLHALTRDLPLSAFVLFSSASATVGNAGQGNYAAANAF
LDALAQHRRALKLPAQSLAWGLWERRSTMTGTLTAADLRRMSRGGTAAIGSEEGLALFDA
ALTLDEPLLVPVRIDLGRLRAAARTAPVPALLSALVPGAVRRPASGADAAEADSLRRRLT
GLPPEERLATLLDLVRSRGADILGHGGAGAIDPDQPFKDLGFDSLTSVELRNRLGAATGH
RLPATLVFDHPTPAAVAAYLSRRLVPDGPGGTDVNARAARTPDREDHEISSLLATIPPAA
LRRAGLLDALLDLADRPETPASAADGAEGIDGIKDMAVDELVRMALGGERD
NT seq 10596 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagtacctcaaccgggtgaccatcgacctgcggaacacccggcagcggctccgg
gaggccgaggcccgtacgagcgagcccatcgcgatcgtgtccatggcctgccgcttcccc
ggcggtgtccgcacccccgaagacctgtgggacctgctcgccgagggccgcgacaccgtc
gcggccgtccccggcgaccggggctgggagaccgtctggccgtccggcggtacggtcccc
gggcagggggcgttcctggacggcgcggccgacttcgacccggagttcttcggcatctcg
ccccgtgaggcggtcgcgatggacccgcagcagcggctgctgctgatggcgtcctgggag
gccgtcgagcaggccggcatcgacccgatcaccctgcggggcagccgtaccggggtgtac
gccgcggccatcgaccaggggtacgcgacgctgggccccggtgccgccgaagccgtccag
gggttcctgatgacggggaactcgatgagcgtgatgtccgggcgggtctcctacgcgctc
ggtctcgagggccccgccgtcaccgtggacaccgcctgttcggcctcgttggtggccctg
cacctcgcggcgcgggccctgcgggccggtgagtgctcgctcgccctcgcgggcggggtc
agcgtgatggcgctgcccgcggtgttcgtcgagttcagcaggcagggcgcgatgtccccc
gacggccgctgcaagccgttcgcggcggcggcggacggcaccggctggggcgagggcgtg
gggatgctgctcctggagcggctgtcggacgcgcgccgcaacggccgtacggtgctggcc
gtgctgcgcggctcggcgatcaaccaggacggcgcgagcaacggactgacggcgccgaac
ggcccgtcgcagcagcgggtgatccgggcggcgctggcggacgcggggctgaccgcgtcc
gaggtggacgcggtggaggcgcacggtaccggcaccacgctgggcgatcccatcgaggcc
gatgcgctgctggccacgtacggtcaggaccggtccgccgaacagcccttgtggctgggg
tcgctgaagtccaacatcgggcacacccaggcggcggccggggtcgccggggtcatcaag
acggtcctcgccctgcggcacggtgtcctgccgcgcaccctgcacgtggacgcgcccacc
ccgcacgccgactggtcatcgggcgccgtcgaactcctcaccgaggcccgcgactggccc
gccgttgaccggccgcgccgggccggggtgtcctcgttcggcatgagcggcaccaacgcg
cacgtcgtcctcgaacaggcaccggaaccggaaccggccgaacaggcaccgggaccggcc
gagcaggcacccgagtcggaaccggccgacggatcgggagcggtgaccgacgcgccggaa
gcgcggactgacgggccgtcggtggagccggacccggcgggcccgcccggagccgcgctg
ccctgggtgctgtccggccgtaccgcctccgcgctcggggaccaggcggcccggctgcgt
gcccggttcgccacggacgcgtccgtacggtcggccgacatcgggttctcgctggcgacc
acccggtccgccttcgaacaccgggccgtcgtgatcggcgacgggcaccacgcactgctg
aacgggctcgccaccctgtccggaccgggcggggacctccacctccccgtcggcctggct
gcggattccgctgccccggccccggctgtcggccgggcttcggatgccgcttccgccgac
atcgtcaccggcaccggccgggtcgtcgaaggccggacggcactggtcttccccggccag
ggctcccagtgggacggcatggcccgggacctgctcgccaccagccccgccttccgggac
cgcctcgccgcctgcgacgccgccctctccgcccatgtcgactggcggctccccgccgtc
ctggagggggcgcccggggccccctccctggaacgggtggacgtggtgcagccggtgctg
tgggcggtgatggtgtccctggccgcgcactgggagtcgtggggcgtccggcccgacgcc
gtggtcgggcacagccagggcgagatcgccgccgccgtggtggcgggagcgctgagcctg
gaggacggggcgaaggtcgtcgccctgcgcagccgggccatccgggcgctggccgggctc
ggcggcatggtcgcggtgcccctgcccgaggacgaggtccgcgccgcgatcgccccctgg
gccgagaagctgtcggtggccgccgtcaacgggcccgccgccgtggtggtctcgggggag
ccgggggccctcgccgaactgctcgcccactgcgccgcacggggcgtacgggcccggtcc
gtacccgtggactacgcctcgcactcggcccaggtcgaacggatcaggtccgaggtgctg
gtcgcgctggacggcgtacgcccgctcccggcccgtacaccgctgttctccaccgtcacc
ggcgaccggctcgacaccacggccatggacgccgactactggtaccgcaacctgcgcggg
accgtccgcttcgacgcggccgtacgctccctggtcgagcagggccacgaggtcttcgtc
gaggtgtcgccgcacccggtgctgaccatggccctccaggacaccgccgaggccaccgga
ggcgcggagccgcccgtggtcgtcggcaccctgcgccgtgacgacggcggaccgcgccgg
gccctgcgcgcggccgccgaactatgggtggcgggcgtggccgtcgactggtccgccgtg
tacgccggtagcggcgcccgcccgaccgccctgcccggataccccttccagctgcggcgc
tactggctggagccggagacggcgcccggcaccggaccggccgccgccgacccgcacgac
acggccttctggcacatggtcgaccacgacgacccggccgagatcgccgcccgcctcgcc
gtcgacgaggacgccctcacccccgtactgccagccctgcgcggctggcgcgaacagcgg
cgcgacgagagcgtcatcgactcctggcgctaccgcatcggctggcagcccctgcccgac
ccacaggccgccaccccggctgccgggacctggctcgtcgtgctgcccgccggagacgac
gacacacgggtacgcggcccgctgctcgccctcgccgaagcgggcgccaccgtcgtcacc
gcggaactcacggccgacgccgtccgccgtacggacctcgcggacacgctcgccaccgcc
ctcggcggcctcgtcccgacgggcgtgctgtcgctgctggccaccgccgaccggccccac
cccgaccacccggccctgcccaccgggacggccctcaccgtcgccctggtgcaggccctg
ggcgacctcggcctcacggcccccctctggtgcgccaccaccggggccgtgtcgacgggc
ccggacgacccggtcacccacccccgccaggcgctggtctggggcaccggactggtggcc
gcgctcgaactgtccgcccgctggggcggcctcatcgacctgcccccggagctcgacgcc
cgcgccaggacccggctcgccgccgtactgacggcctccgtccccggcccggacggcgtc
ggccgcgaggaccagctcgccctgcgccccaccggcatcctggcccgccgcctccggcgc
gccccccggagcgacagccgtacgaaccgtacgaaccgtacgaaccgctggaagccgcgt
ggcaccgtcctgctgaccggcggcaccggagccgtcggcccgcacctcgcccgctggctg
gcccgcagcggcgccacccacctcgtcctgcccggccgccgcggcccccaggcacccggc
gcggccgaactcgccgccgaactggccgccctcggcgtacgactgaccctgcccgtctgc
gatctgtcggaccgccaggcggtggcggagctgctcaccggcctggagacggcgggcgac
ccggtcaccgcggtcgtccacgcggccgccttcgtcgcgctcgccccgctggacggcaca
ccgatgtccgcgttcgaacagatcgtcgccgccaaggccgcaggcgccgaacacctcgac
gccctgctcgaccgcgaactcgacgccttcgtcctgttctcctcgatcgccggagtctgg
ggcagcggtgaccacggcgcctacgccgccgccaacgcctacctcggcgccctggcccag
caccgccgggcccgcggcctcaccgccaccaccctcgactggggcatctggcaggccgag
aacccctggcaggaccgcgtcgccggagaggacgccgacctgttcaacctggaacagcac
ggcctgccccggatcgcccccgacctcgccgtccaagccctgtgccaagcgctagacgac
gacgagaccgtcctcaccgtcgccgacgtcgactgggagcggttcgccgccgtcttcacc
tccacccgccccagtccgctgctcaccggcatccccgaggcccgccgcgccctggaggcc
gcgaccggcgacacggaggcacccgccgccgccctgctgcgccaacggctcgccgccctc
gccgaatccgagcagcaccgcctgctgctcgacctggtccgcacccatgccgcagccgtc
ctcggccatgccacggcggacgcgatccggcccggcaaagccttccaggacatgggcttc
gcctccctcaccgcagtcgaactccgcaaccggctcaacgccgccaccggactgcgactg
ccgtccaccctgatcttcgaccacccctcgtcgaccgcgctcgcccaggagatccgcgcc
gaactgctcggccgacagaccaccgacccgcacctccccgagccggactcctccgtcccg
gaccgctccgtcccggactcctccgtcccggaccgctccgtcccggactcctccgtcccg
gaccgctccgtcccgggcgctgccgcgcacctgtccgcacctgccgacgaaccgatcgcg
atcgtctccatggcctgccgcttccccggcggcatcggcacccccgaagagctgtggcgc
ctgctcgccgacggcggcgacgccgtctccgacctccccaccgaccggggctgggacatc
gaggccctctacgaccccgaccccgaccaccccggcacctcgacgacccggcggggcggc
ttcctccacgacgcggccgatttcgacgcggagttcttcggcatctcgccgcgcgaggcc
ctggccatggacccgcagcagcggctgctcctggaaaccacctgggaggcgatcgagcgc
gcggccatcgacccggacgccctgcgcggcagccgcaccggagtgttcaccggcgtcaac
tacgccgattacgcggccgtcgtcgcccagtcggaggaaggagacggccacctgctcacc
ggcagcgcacccagcgtcgtatccggccgggtcgcctacaccctgggcctcgaaggcccc
gcagtgaccatcgacacggcttgctcctcctccctcgtcgccctgcacctcgcaggccgg
gcgttgcgcgggggagactgctcgctcgccctggtcggcggcgtcgccgtgatggcgacc
cccggcgccctcatcagcttctcccgtcagcgggggctcgccgaggacggccgctgcaag
gcgttctcggacgacgcggacggcatgggcatgggcgagggcgtcggcgtgctgttgctg
gagcggctgtcggacgcccgccgcaacggacacccggtcctggcggtggtacgcggctcc
gccgtcaaccaggacggcgccagcaacggcctctccgcccccaacggcccctcccaacag
cgggtgatccgggcggcgttggcggacgcggggctgacggcgtccgaggtggacgtggtg
gaggcgcacggcaccggcaccactctcggcgatcccatcgaggcccaggcgctgctggcc
acgtacggccaggaccggcccgccgaccggcccctgctgctcggctccctcaagtccaac
ctcggccatgcccaggcggcatcgggggtggcaggggtcatcaagacggtgctctccatg
cggcacgggcaggtgccccgcaccctgcacgtcggcaggccctccggccatgtcgactgg
acccgcggagcgctggccctcgcgaccgagcagcagccctggccgctccacggccgcccc
ctgcgggccggggtgtcctccttcggcctgagcggcaccaacgtccacaccatcctcgaa
cacgcccccctggagaacgacgccccgacggccgagcgcgtccccctgtcggcggttccc
tggctgctgtcggcgaagagcccgcaggccctgcgctcccaggctgaccgtttacgccgt
cacctggacggcagccccgtacccgacccgcgcgacatcgggtccgccctgcacgcccgc
accgccttcgagtaccggagggcgctgatcggagaacgggaccaactccccgccctgctc
ggccagatggccgacgacgactcgggagcgtgggacggcggacgtacggtcgacggtcgt
tcggtgctcgtcttcccgggtcagggttcgcagtgggtggggatggctgcggagttgttg
ggggagtcggaggtcttcgcggcgcggatgggtgagtgcgagcgggccttggagccgtac
gtggattggtcgttgacggaggcgctggggtcggagcggttgttggggcgggtcgatgtg
gtgcagccggtgctgtgggcggtgatggtgtcgttggccgaggtgtggcgttcgttcggt
gtggcggtggacggggtggtgggtcattcgcagggggaggttgcggctgcgtgtgtggcg
ggtgggttgagtttggatgacggggcgcgggtggtggcgttgcgttctcgtgcggtgggg
gtgttggcggggcggggtggtatggcgtcggtgccgttgtcggtggacgtggtgcgggag
cgtatcgccccgtgggcgggccggttgtcggtcgccgcggtcaacgggccttcttcgacg
gtgatttcgggtgacgccgacgcggtctccgggcttgtggaggagttcaccggtgagggt
gtgcgggcgcggctgatcgaggtggactacgcgtcgcattcctcccatgtggaggagatc
cgtgagcagttgctctccgacctggaaggcattacgcctctttccggtgcggtgccgttc
ttctcgacggtgacggggggctggctggatacgaagggtctggacgcggagtactggtac
cggaatctgcgcgagaccgttcagttcgggagcgcgacggagacgctgctggctgatggt
ttccggttcttcatcgaggcaagtccgcatccggtgctgggtgtggcggtgggggagtcg
gcggaggtggccggtgtggaggccgctgtgctggggaccttgcggcgtcaagaaggctgc
ctggagcaggtgttgcgtgcggtgggccgtgcgtgggagcgggggttgggggtcgattgg
gcgggggcgttcccgggggctcggcgggtcgagttgcccacgtacgccttccagcgcagc
cgctactggcccgagccggcgcccaccacggcggccgacgtgggctcggccgggctcgac
tccgccgaccatcccgtcctcggagccgccaccgagctggccgacacgggtgaactgctg
ctcagcggccggttgtcgctgcgcacccacccctggctcgccgaccacgccgtggccggt
acggtcctgctgcccggcgcggccttcgcggaactcgccgtacgcgccgcggacgaggcc
ggatgccacacggtggaggaactgacgctccagacaccgctgttgatccccgccgacacc
gccgtacgcctgcaagtacgggtcggcgcggcggacacgcacggcagccgctccctggac
ctgttctcctgccgtgaggacgcgacgaccccgcagtggaccgcgcacgccaccggcgta
ctcaccgccgacgccgcgaaccgcaagccgccgcccgcaccggacgaccccggctcctgg
cccccgcccggcgccgtcccggtctccgtcgatgacctgtacgagcggttccacggctcc
ggctacggctacggacccgccttccgcgggctcaccagcgcctggcgccggggcgacgag
atcttcaccgaggtacgcctgcccgaggaccagcaccggtccgccgccgccttcggtgtg
caccccgccctcctggacgccgccctccaggggctgttcctgcgtgcccggccggagagc
ggaccggacccggaccggccgtccgccggactgccgttctcctggagcggagtcaggctg
tacgcctccgcggccaccgcgctcagggtacggctcggcttccggccggacggttcggtg
gcgatcgacgcgaccgacccgaacggcctcccggtcgcgtcggtcgaggcgctcgccgtc
cgcccgatcgatctcgacgccctccgcccgggcggaggtccggaatccctctaccgggtg
cagtggtcggcggtgcccgacaccgcacccgtcggccccctcggaccctgggccgtcctc
ggcggccggtcactctccccggacacggacagccatccggacctggccgcgctcggtgcc
gtgctggacgggggagcgccgtcgcccgccgccgtgctggcctggtgcgaccacaccccg
cgcctctcgtccccgcccgacgccgcatccgtacacaccgcactggacgacgccctgcgg
ctcgtccaggagtggctggccgacccgcgttgggacgacggcacccgcctcgtactcgtc
acccggggcgcggtctccacggcggccggtgaggaggttaccgatctgaccggcgccgct
gtccgtggtctcgtccgctccgcccagtccgagcacccggaccgcttcctgctgatcgac
accgacgacccggccgccgtgaccggcctgctgccccgggccctggccgcaacggaaccc
caactggcgatccgcaccggacaactcctcgccgcccgcctcacccgggccaccgtcacc
acgaacccgaaccctggcacgcacgcgctcgcggacccgaacccgggcacggacgcgcac
ctccgtacgggcgtgctcacagacccggactcggcctcggcccccggcaccccgtcccgt
atcgccgtgcccggcggaaccgtcctcgtcaccggagcgggcggcgcgctcggcggtctg
gtggcccggcacctcgtgaccgcgcacggcgtacggaacctgctgctcgtcggcaggcgc
ggtgcgggcgccccgggcctggccgacctcgccgccgacctgcgcggtctcggtgcccgg
gtggacgtggcggcgtgcgacgtcgccgaccgggacgcgctcgccgccctgctcgacggc
atccccgccgaccgtccgctgagcgcggtcgtccacgcggccggagtcctggacgacggg
accgtcgagtcgctgacccccgcgcggatgcgccacgtcctgcggcccaaggtcgacgcg
gctctccacctgcacgccctcacccgtgatctgcccttgtcggccttcgtcctgttctcc
tccgcgtccgccaccgtcggcaacgccggtcagggcaactacgcggccgccaacgccttc
ctcgacgcgctcgcccagcaccgccgcgctctgaaactgcccgcccagtcgctcgcctgg
ggcctgtgggaacgccgtagcaccatgaccgggacgctgaccgccgccgacctgcggcgc
atgtcccggggcggcaccgcggccatcggcagcgaagaaggtctggcgctgttcgacgcg
gccctcaccctggacgaaccactgctcgtaccggtccggatcgacctcggccggctccgg
gcggccgctcggaccgcacccgtcccggccctgctctccgccctggtccccggcgccgta
cgccgcccggcctccggggcggacgccgccgaagccgactcgctgcgccgccgcctgacc
ggcctcccgccggaggaacgcctcgccaccctgctcgacctggtacggagccggggcgcc
gacatcctcggccacggcggagccggggccatcgacccggaccagccgttcaaggacctc
ggcttcgactcgctcacctccgtcgaactccgcaaccggctcggcgccgccaccggccac
cggctgcccgcgaccttggtcttcgaccatcccaccccggccgccgtcgccgcctacctc
agcaggcgcctggtgcccgacgggccgggcggcaccgacgtcaacgccagggccgcccgg
acgccggaccgcgaggaccacgagatcagctccctgctcgccacgatcccgcccgccgct
ctgcgccgggccggtctcctcgacgcgctcctggacctcgccgaccggccggagacaccg
gcttccgccgccgacggcgccgaaggcatcgacggcatcaaggacatggccgtcgacgaa
ctcgtccggatggccctgggcggcgaacgtgactga

DBGET integrated database retrieval system