KEGG   Kazachstania africana: KAFR_0B05670Help
Entry
KAFR_0B05670      CDS       T02487                                 

Gene name
KAFR0B05670
Definition
(RefSeq) hypothetical protein
  KO
K12158  ubiquitin-like protein Nedd8
Organism
kaf  Kazachstania africana
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:kaf04121]
    KAFR_0B05670 (KAFR0B05670)
Ubiquitin system [BR:kaf04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   KAFR_0B05670 (KAFR0B05670)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD TBK1_ULD Ubiquitin_2
Motif
Other DBs
NCBI-GeneID: 13884745
NCBI-ProteinID: XP_003955998
UniProt: H2AR63
LinkDB All DBs
Position
2:complement(join(1169417..1169441,1169546..1169694))
Genome map
AA seq 57 aa AA seqDB search
MFIKVKTLTGKEIAVELDENDRIYHIKELLEEKEGIPPSQQRLIFQGKQIIEMTNKL
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgtttataaaagtgaaaacgttaacggggaaagaaatagctgtcgagttggacgagaac
gatcgtatttatcatatcaaagagcttttagaagaaaaagaaggtattccaccttctcaa
caaaggctgatatttcaaggaaagcaaattatagaaatgacgaacaaactgtaa

DBGET integrated database retrieval system