KEGG   Kazachstania africana: KAFR_0B05680Help
Entry
KAFR_0B05680      CDS       T02487                                 

Gene name
KAFR0B05680
Definition
(RefSeq) hypothetical protein
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
kaf  Kazachstania africana
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kaf03012]
    KAFR_0B05680 (KAFR0B05680)
Enzymes [BR:kaf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     KAFR_0B05680 (KAFR0B05680)
Translation factors [BR:kaf03012]
 Eukaryotic type
  Release factors
   KAFR_0B05680 (KAFR0B05680)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 Methyltransf_33 Methyltransf_23 PrmA Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 13884746
NCBI-ProteinID: XP_003955999
UniProt: H2AR64
LinkDB All DBs
Position
2:1169896..1170564
Genome map
AA seq 222 aa AA seqDB search
MLPTPYVKCDYSKVYEPSEDSFLLLDALEEDKQYLQQKFQNQLAVVCELGPGSGIVTTFL
MQNEIPIKNSLYFAVDINPWALETTLDTAKRNSCEKYFMDPVRSSLCSSFRNNEIDLLVF
NPPYVPAEEVPLIPKSKEYIDEWLDLALLGGKDGMDVTQIVLDNLNQTLSTKGIAYILFC
ARNKPEEVVKLMKKKYNWDSKLIVHRKAGWEVLSVYRFYKDI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccactccttacgtcaaatgtgactattccaaggtctatgaaccctcagaagat
agctttctcctactggacgctctagaagaggacaagcaatatctacaacaaaaatttcaa
aatcaattagctgtggtatgtgaattgggacctggatcaggcattgttacgactttctta
atgcaaaatgaaattcctatcaagaattctttgtactttgcagttgacatcaatccatgg
gcattagagactaccttagatacagcgaagagaaatagttgtgaaaaatattttatggat
ccagtacgatcaagtctctgttcttcatttagaaataatgaaattgatcttttagtattc
aatccaccttatgtccctgctgaagaagtacctttgataccgaaatcaaaggaatatatc
gacgaatggctcgatttagccttgttaggcggcaaagatggaatggatgtcactcaaatt
gttctagataatttgaatcagacactttctaccaaaggcatagcttatatattgttctgt
gcaagaaataaaccagaggaagttgtaaaactgatgaaaaagaaatataactgggatagt
aaactcattgtccacagaaaagctggttgggaagttttgagcgtttatagattttataaa
gatatctag

DBGET integrated database retrieval system