KEGG   Kazachstania africana: KAFR_0B05690Help
Entry
KAFR_0B05690      CDS       T02487                                 

Gene name
KAFR0B05690
Definition
(RefSeq) hypothetical protein
Organism
kaf  Kazachstania africana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N
Motif
Other DBs
NCBI-GeneID: 13884747
NCBI-ProteinID: XP_003956000
UniProt: H2AR65
LinkDB All DBs
Position
2:complement(1170640..1175718)
Genome map
AA seq 1692 aa AA seqDB search
MSLPLKPFAIDSTSKQLDSKQKKFNTNVQRALERFDSVTEWADYIASLGSLLKALQSWSP
KFQNVKYFVPSPYQVSRRLTSSLSPNLPSGVHQKTLEVYTYIFQNIGIETLAAECNIWIP
GILPLMSYASMSVKSRLIELYDTYLVQVPSETLKMLVRPLLASLLPGIDDESSEFLSLNL
KLIETLKTNLGDDSLFWQTCFIVVASSKDRRLGGLVWLTRNFPSLNAVPHLVSQQSKSFQ
ESGKNEESDTIQEKKNKQAVALSVVLPEAKSVVSPEPGLLIRCLIRCLDDENDLLLKRGI
LDLLIQRFHLNSPVLQNLVTENDRKLLILWCCRTTLSKDMSLNRRVWNWLLGPSIVSTSR
SNSENNTATTAETSSKESLGGSEYFTMYGLSSLISGLKDMITDEASLVTTFRICLAFMDR
WEIGSLVIPTMFIPMLNASKQFADKQQVIQAANTFFDAVETNIIWGKIIQYVVTNKDLHL
LSYVLKCFNVENDEEIIVRHLPLVLLTLLSYNSVNESTDVSSKKQRYDIFKQLLGYIPER
SFLPLDTSTMDVQNRPTHQDILAKIQNYYRKVSDFSNSQELEASTELELPFSTEDATFLI
AMSIQDLVLQDLRNKSTINESASLFVEIFEKIPESAGTNDVKQSSWSVNELFQSLLDYVN
SKEGRGSSLWGVIDIYSHYLANRLPFLDSMKLLNVLMKSLCLCMVSPKNQLVAIKSLKSL
ERMLPSKYIQGALASAFVKETDVLQRILILDLLWNELESYRSLIRQPLEIVLDELFDKQN
PHYLSVSKWVLASVHSGSSSRLFQMLAEGLLDFNFLENDVISDLDDLEMFTYRLQLITNV
LKINSSIIVKNFSSELTSLNSLGKWENEDVSTYKNLVLVIILKFLKLKNNKNAKSMRSAL
ILLDSLLDGTESNFKDIVIFLLEMSSKYLRKGEVPYELIAVSLLDIVSKVLRLSHENNIK
LDIFDDNSTHLKYIDYMVTSVSTMTSSLVITSYVKLLSESIAYFEGSIFRVILPLSASSV
QCVQRLLLLEKEHGGYYQSISLLLEGLEELLQVSHGYLSVEEREGYFSGSGARTDFIQSV
VSNVFSSDASDVSTRIQGERDVVLQSIRQVAICCFEIWSWAHSIAGSTDLGANGEQVNYN
SFKFKFKSKVLLEKLFMLEPLEILENLVNLQSNDMIALVHVLDGNKPAVSLPYFFYGVVM
RYNKNTTSKFSINLAGNKGSHLRTNRIEPSLINKLRGETIMNFVISYANSLENAAVEDFF
EDFLTFFKEIVANYSMYNRIHLQVLELVGIIALKLDKSQFGEQKRIRRDFADLFARYVPN
IAAELLDEETEELEAFSILEKFVPKVQYIVHEEIGGDRYNAVLSSIVTHCLVPRIKNKSD
NIPPYVLKLAENISTVGAKVKVWKSLISDIFNDDKQLPILGNNAIWNKIIFEWSQYPENK
SKLLNDLLLVTGSKRMGMTPVLITFSSWNDTEIGTKCQNLSRISYLLLVAPVDTYLLEFQ
SLISCVCQYLVSNEFKLKEKCWVLLRVMFLKFSESHFNEYWSMISYCLQTNLQEFYEFLQ
LQEEIEPMVILQLCKTLDLLLALQREGFSATNEWLFIIDTINCIYKNGAYMALVDKISEV
KDYAMGRADDFEMTNSVEEGSPMLTGVHSIQKHSQLRNFFHSLSYTRYEVNYAMKMPKAE
ASEADVMGDLFH
NT seq 5079 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgccgttaaaaccatttgcaattgactccacaagtaagcaattggattcaaaa
caaaagaaatttaatactaatgttcagcgtgctttagaacgtttcgattcagtaacagaa
tgggcggactatattgcttccctaggctcattattgaaggccttacaatcatggtcacca
aaattccagaacgtcaaatactttgttccatcaccatatcaagtcagtaggaggctgacc
tcctctctctctcctaatttaccttcaggtgttcatcaaaaaactttggaagtatatacc
tacatttttcagaatattggtattgagacattagctgcagaatgcaatatttggataccc
ggtatattacctctaatgtcatatgcatctatgtcagtaaaatcacgcctgattgaatta
tatgacacatatctagttcaggttccttctgaaacattgaaaatgctagtaagacctttg
ctcgcatccttattgcctggaattgatgatgaaagtagtgaatttttatcactaaatttg
aaattgattgaaactttaaaaacaaatcttggagatgattctctgttttggcagacatgt
ttcatagtggttgcaagcagtaaggatcgtagactaggtgggcttgtatggctcaccaga
aatttcccatcgttgaatgcagtccctcatttggtctcgcagcaaagcaaatcgtttcaa
gaatcaggaaagaatgaagagagcgatacaattcaagagaagaaaaataaacaagcagtt
gccctttctgtggtccttcctgaagcgaaaagtgtggtttcaccagaaccggggttatta
atacgttgcctgatacgttgtttagatgatgaaaatgatcttcttcttaaaaggggaata
ttagatttgttaatccaaagatttcacctcaattcccccgtattacaaaatttagtcact
gaaaatgatagaaagctccttattttatggtgttgtagaactacattgagcaaagatatg
tcactgaacagaagagtatggaactggcttttgggaccctccattgtctcaacttctagg
agtaattctgaaaataatacagcaactacagctgaaacaagttccaaggaaagtctgggt
ggcagcgagtacttcactatgtatggtctaagttcgttgatttcaggcctgaaagatatg
ataacagatgaagcttccttggttacaacttttagaatatgtttagcattcatggataga
tgggaaattggctctttagtgatacctacaatgtttattccaatgctaaatgcctctaaa
caatttgcggacaagcagcaagttatccaagccgctaacacctttttcgatgctgtggaa
acaaatattatttggggtaaaataatccagtacgttgttaccaacaaggacttgcactta
ctgagctacgttcttaaatgctttaatgttgagaatgatgaggaaatcattgttcgccat
ctacccctggtattgttgacattattatcctataattcagtaaatgaatctacggatgtt
tcctcaaagaaacagcgctatgatatatttaaacaacttctcggatatataccggagcga
tctttcttaccattggatacatctactatggatgttcaaaataggcccacacatcaagat
atattggcaaaaatacagaattattacagaaaggtgtccgatttcagcaactcccaggaa
ttagaagcatcgacagaattagaattgccattctctactgaagacgcaacatttttgatc
gcgatgagtatacaagatctggttttgcaagacttgaggaataaatctactataaacgag
tcagcaagtcttttcgttgaaatttttgaaaaaattccagagtctgcaggtacaaatgat
gttaaacaatccagttggtcggttaatgagttgtttcaatcattgcttgactatgtcaac
tcaaaagagggaaggggttcctccttgtggggagtcatagatatctatagccattatctg
gcaaatagactgcctttcctagattccatgaagcttctcaatgtactcatgaaatcctta
tgtttatgcatggtttccccaaaaaatcaactggtagccatcaaatctttgaaatcgtta
gaaagaatgcttccttccaaatacatacaaggtgctttggcctctgctttcgtgaaagag
acagatgttttacaaaggatattgattctagacttactttggaatgaacttgagtcttat
agatcgttgataaggcaaccgctggaaattgtacttgatgaacttttcgataaacaaaat
ccgcattatttaagcgtttctaaatgggtactagcatcagtacattctggttcttcatct
cgcctttttcagatgctagcggaggggctgttggacttcaactttttggaaaatgatgtt
atatccgatttagatgatttagaaatgtttacttatagacttcaattaattactaatgtc
ctaaaaattaattcatccataattgttaaaaactttagttccgaacttacatccttaaat
tctttgggaaaatgggagaatgaggatgtatctacctataaaaacttggttctcgtaata
atcctgaagtttttgaagctaaagaataacaaaaatgcgaaaagtatgagaagtgcatta
attctattagattctctactagatggtactgagtccaatttcaaagatatagtcatattt
ttacttgaaatgtcctccaagtatttgagaaaaggagaagtaccttatgagcttattgct
gtttcattacttgacatagtctctaaagttttgagattgtcgcatgaaaataacatcaag
cttgatatatttgatgataattcgacacacctgaaatacatagactatatggttaccagt
gtttctacgatgacaagttcattggttataacatcatatgtcaaacttttatcagagagt
atagcgtattttgaaggttctatatttagagttatattacctttatcagcatccagcgtc
caatgtgttcaacggctcttgcttttagaaaaggagcatggaggatattatcaatcaata
tcacttttattagaagggttggaggaattactgcaagtatcacacggatatctttcagtt
gaagaaagagaaggttactttagcggttcaggtgccaggacggactttatacaatctgtc
gtatcaaatgttttctcttcagatgcttcagatgtttctacaagaatacagggtgagcgt
gatgtcgtactacaatcaattaggcaagtggcaatttgctgtttcgaaatttggtcatgg
gcacatagtattgctggctcaacagacttgggcgccaatggagagcaagtaaactataat
tcatttaagtttaagttcaaatctaaagtattactagaaaaactattcatgctggagcca
ttggaaattctagaaaacctagtcaatctccaatcaaatgacatgattgctcttgtacat
gtactagatggtaataagccagccgtatcgttaccatatttcttttatggtgtggttatg
agatataataaaaatacaacttcaaaattttccataaatttagcaggtaataagggatct
cacttgaggacaaacagaatagaaccatctttgattaacaagttgagaggagaaactatt
atgaattttgttatcagttatgcaaattccttggagaatgctgcagtagaggatttcttt
gaagattttttgacgtttttcaaggagattgttgcgaactattctatgtacaatagaata
catttacaagtcctagagcttgtaggaattatagcattaaaattggataaatcacaattt
ggtgaacaaaaaaggattaggcgggacttcgcagatttattcgcaagatatgtgccaaat
atagcagcagaactgttagatgaagaaacggaggaattagaggctttttcaatcctcgag
aaattcgtgccaaaagttcaatatattgtgcatgaggaaattggtggtgataggtataat
gctgtactgtcgagcattgttactcattgtctcgtaccaagaattaagaataaatctgat
aacattccaccttacgttttaaaactagcagagaatatttccaccgttggtgctaaagtc
aaagtgtggaaaagtttgatttctgacatctttaatgatgacaaacagctgccaatactc
ggtaataatgccatatggaataagataatttttgaatggtcgcaatatcccgaaaataaa
tcaaaacttttaaatgatttgcttcttgttaccggttcaaaacgaatgggtatgacccct
gtgctgataactttcagctcatggaatgacactgaaattggaaccaaatgtcaaaattta
tctaggatttcttatttactgttggtggctccagtggacacgtatctgttggaattccag
tcattgatttcatgcgtttgtcagtatttagtgtcaaatgagtttaaattaaaggaaaaa
tgctgggtcttgctaagagtaatgtttttgaagttttccgaatcacacttcaatgaatac
tggtctatgatttcctactgtttgcagacaaacttgcaagagttttatgaatttttacaa
ctccaagaggaaattgagcccatggttattttgcaattatgtaagacgttggatctattg
ttggcactacaaagagaaggttttagtgcaacaaatgaatggttatttattattgacact
atcaattgtatttataaaaacggagcatatatggcgttggttgataaaatatcagaggtc
aaggattatgccatgggtagagcggatgattttgaaatgacgaattcagttgaagaggga
agccccatgctgactggtgttcatagcatccaaaaacatagtcaattaaggaatttcttt
cattctttgagctataccaggtatgaggttaattacgctatgaaaatgccaaaggcagaa
gccagtgaagcagatgttatgggagatctattccattag

DBGET integrated database retrieval system