KEGG   Kazachstania africana: KAFR_0B05700Help
Entry
KAFR_0B05700      CDS       T02487                                 

Gene name
KAFR0B05700
Definition
(RefSeq) hypothetical protein
  KO
K13341  peroxin-7
Organism
kaf  Kazachstania africana
Pathway
kaf04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    KAFR_0B05700 (KAFR0B05700)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 13884748
NCBI-ProteinID: XP_003956001
UniProt: H2AR66
LinkDB All DBs
Position
2:complement(1176020..1177138)
Genome map
AA seq 372 aa AA seqDB search
MLGYHMKGFSGYGVQYSPFFDNKLAVATGANFGLVGNGKVYLLEIDSKGQIHETNSFLTQ
DCLFDVAWNELHENQVLVAQGDGSLRLFDTTLKDYPIEIFNEHEREVFSCSWNLITKNTF
TSSSWDGTVKIWSPLRKASLLTLVPHPLKVMKNFDQVDIPISNQKAHTAISKNKNCIYQA
QFSPHDPNLVICCAGNSYTTLFDLRQPSTSNNQQNFFSHSGLEALTCDFNKYRPNIVATG
GVDNTIRIWDLRMLSKQFQAGTQRDNSIMCVNEIKKGHELAVRKVSWSPHSSTTLLSTSY
DMTCCVWQDLSSNGKAPTGKTNSTDFRRGCITRFNQHSEFVFGADWSLWGQPGFIASTAW
DGNVFVWNAFRK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgttaggctaccatatgaaaggatttagtggatatggtgtacagtactccccatttttt
gataacaaactagcagtggctacgggggcaaatttcggattagtgggtaatggtaaagta
tatctattagagatagattcgaaaggccaaattcacgaaaccaactctttccttacacag
gactgtctgttcgacgtagcgtggaatgaattgcatgaaaatcaagttttagtggctcaa
ggagacgggtctttacgtctttttgatactacattaaaagactatcccattgagattttc
aatgaacatgagagagaagtttttagttgttcttggaatctcattactaagaatacattc
accagtagttcatgggatggtactgtaaagatatggtctcctttgaggaaggcaagttta
cttacattggtcccacatcctttaaaagtaatgaaaaatttcgatcaggtagatatacca
atttccaaccaaaaagcccatacggccatttcaaagaacaaaaattgtatatatcaggca
cagttctcaccacatgatccgaacctagtgatatgctgcgcgggtaactcatataccacg
ctctttgatttaaggcagccttcaacatccaataaccaacaaaatttcttctctcactcg
ggattggaagctttaacctgtgacttcaataaatataggccaaatatagtagcaactggt
ggtgtcgataatacaataaggatttgggatttgagaatgctcagcaagcaatttcaggca
ggcactcagagagacaattcaataatgtgcgtcaacgaaatcaagaaagggcacgaattg
gcagtaaggaaggtttcatggtcacctcatagctcaactacactgttgtctacttcatat
gatatgacatgctgtgtgtggcaagatctgagttccaatggaaaagcaccaacgggtaaa
accaatagcacagatttcagaagaggttgtataacaaggtttaatcaacattcagagttc
gtcttcggcgcagactggagtttatggggtcaacctggatttattgcatctaccgcctgg
gatggtaacgtgttcgtttggaacgcattccgtaaatag

DBGET integrated database retrieval system