KEGG   Kazachstania africana: KAFR_0F02710
Entry
KAFR_0F02710      CDS       T02487                                 

Gene name
KAFR0F02710
Definition
(RefSeq) hypothetical protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
kaf  Kazachstania africana
Pathway
kaf04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    KAFR_0F02710 (KAFR0F02710)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kaf01001]
    KAFR_0F02710 (KAFR0F02710)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KAFR_0F02710 (KAFR0F02710)
Protein kinases [BR:kaf01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   KAFR_0F02710 (KAFR0F02710)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Choline_kinase APH DUF3271 MMR_HSR1_Xtn RICTOR_M
Other DBs
NCBI-GeneID: 13884336
NCBI-ProteinID: XP_003958003
UniProt: H2AWW8
LinkDB
Position
6:528336..529493
AA seq 385 aa
MNIESINNQIHIVHKQVYHGHPIDPNQLIISSSSSAAPSNNEDPVEISYPTTEVVGHGSF
GVVFTTTLKETNETVAIKKVLQDRRFKNRELEIMKLLKHDNIIDLKYYFYEKDNDQDDIY
LNLILDYMPQSLYQRLRHFVHQRTTMPRLEIKFYMFQLFKALNYMHNFTNVCHRDIKPQN
LLVDPQSWCLKICDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYTNQIDIWSSGCV
MAELLLGQPMFPGESGIDQLVEIIKILGTPTRQEICSMNSNYMDHKFPQIKAIPLNKVFK
KEDNLTIDFLSNTLKYDPNERFLPFQCLIHEYFDELREIHEDYKVKDLNLFKFNEEVEFG
HIKHEHQLQTLKTKLFSRGINVNNY
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaatattgaatccatcaataatcaaattcatatagtgcacaaacaagtctaccatggt
catccaatagatccaaatcaacttataatatcgtcatcatcatcagcagcaccatcaaat
aatgaagatccagtggaaatttcataccctacaacagaagtagtggggcatggttccttc
ggtgtagtattcacaacaactttgaaagaaactaatgaaactgtagccattaaaaaagta
cttcaagatagaagattcaaaaatagagaattagaaataatgaaacttctaaaacatgat
aatataatcgatttaaaatattatttctacgaaaaagataatgatcaagatgatatttat
ttaaatttaatcctagattacatgccacaatctttatatcaaagattacgtcattttgta
catcaacgtactacaatgccaagattagaaatcaaattttacatgtttcaactatttaag
gctttaaattatatgcataacttcactaacgtttgtcacagagatattaaacctcaaaat
cttctggtggacccacaatcttggtgtcttaaaatttgtgattttggttccgctaaacaa
ttgaaaccaacagaaccaaatgtttcatacatttgttcaagatattatagggctcctgaa
ttgatttttggtgctactaattatacaaatcaaattgatatttggtcaagtggttgtgta
atggctgaattattattaggtcaaccaatgtttcccggtgaaagtggtatagatcaattg
gttgaaataattaaaatattaggaactccaacaagacaagaaatttgttcaatgaattca
aattatatggatcataaattcccacaaataaaagcaattccattaaataaagtctttaaa
aaagaagataatcttacaatagattttctaagtaatactttgaaatatgaccctaatgaa
agatttttaccctttcaatgtttaattcatgaatacttcgatgaactgagagaaatccat
gaagattacaaagttaaagatttaaatcttttcaaattcaatgaagaagttgaattcggt
catattaaacatgaacatcaattgcaaacactcaaaacaaaactgttttcaagaggaatt
aatgtgaataattattaa

DBGET integrated database retrieval system