KEGG   Kazachstania africana: KAFR_0G02380Help
Entry
KAFR_0G02380      CDS       T02487                                 

Gene name
KAFR0G02380
Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
kaf  Kazachstania africana
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kaf03012]
    KAFR_0G02380 (KAFR0G02380)
   03029 Mitochondrial biogenesis [BR:kaf03029]
    KAFR_0G02380 (KAFR0G02380)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kaf04147]
    KAFR_0G02380 (KAFR0G02380)
Translation factors [BR:kaf03012]
 Eukaryotic Type
  Elongation factors
   KAFR_0G02380 (KAFR0G02380)
 Prokaryotic Type
   KAFR_0G02380 (KAFR0G02380)
Mitochondrial biogenesis [BR:kaf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KAFR_0G02380 (KAFR0G02380)
Exosome [BR:kaf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KAFR_0G02380 (KAFR0G02380)
  Exosomal proteins of breast cancer cells
   KAFR_0G02380 (KAFR0G02380)
  Exosomal proteins of colorectal cancer cells
   KAFR_0G02380 (KAFR0G02380)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 13887251
NCBI-ProteinID: XP_003958407
UniProt: H2AY22
LinkDB All DBs
Position
7:complement(498283..499578)
Genome map
AA seq 431 aa AA seqDB search
MSLLLPRTVLSTFRFSATKLPRILTTVSSRSYAAQFDRSKPHVNIGTIGHVDHGKTTLTA
AITKILAKSGGANFLDYSSIDKAPEERARGITISTAHVEYETKKRHYSHVDCPGHADYIK
NMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVSKIVVYVNKVDTIDDPEMLELV
EMEMRELLSTYGFDGDNCPIIMGSALCALEGKKPEIGEQSILKLLDAIDEYIPTPKRDLE
KPFLMPIEDVFSISGRGTVVTGRVERGELKKGEELEIVGYNKTPLKTTVTGVEMFRKELD
QAMAGDNAGILLRGIRRDQIKRGMILAKPGTVNAHTKVLASLYILTKEEGGRHSGFGENY
RPQMFIRTADVTAVLKFPGGCEDHSKQVLPGDNIEMECELIHPTPIEEGQRFNIREGGKT
VGTGLVTRIIE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgttgttacccagaacagtgctatcaactttcaggttctcagcaaccaaatta
cctcgtattttgaccaccgtttcatcccgttcgtacgctgctcaattcgaccgttcgaaa
cctcatgtcaacataggtactatcggtcatgtcgatcacggtaagactactttaactgct
gcaattacaaagattcttgctaaatcaggaggcgctaatttcttagactattcttcaatt
gacaaggctccagaagaaagagcccgtggtatcaccatctctactgcacacgtagaatac
gaaacaaagaaaagacattattctcatgtcgattgtccaggacatgctgattacatcaag
aatatgattacaggtgcagcacaaatggacggtgctattattgtcgttgccgcaaccgat
ggtcaaatgcctcaaactagagaacatttattattggcaagacaagtcggtgtgtcaaag
atcgtcgtatatgtcaataaagttgataccatagatgaccctgagatgttagaactggta
gaaatggaaatgagggaattgttaagtacttatgggttcgatggtgataattgtccaatc
attatgggttccgcactatgtgcactagaaggtaaaaaaccagaaattggcgaacaatca
atccttaaattattagacgccattgatgaatatattccaacaccaaagagagatttggag
aaacctttcctaatgcccattgaagatgttttttcaatttccggtagaggtaccgtcgtt
acgggtcgtgttgagagaggtgaattgaaaaagggtgaagaactggaaatcgtaggttat
aataagaccccattaaagactaccgtcacgggtgtcgaaatgttcagaaaggaattggat
caagcaatggctggtgacaatgccggtatcctattaagaggcatcagaagagaccaaatc
aagagaggtatgatcttagctaaacccggcactgtcaacgctcatacaaaggttcttgca
tccttatatatcctaaccaaggaagaaggtggaagacactctggttttggtgaaaattat
agaccacaaatgtttattagaacagcagacgttactgccgtcctgaagttcccaggaggt
tgtgaggatcactcaaaacaagttttaccaggtgataacattgagatggaatgtgagttg
atccatccaacaccaatcgaagaaggtcaaagatttaacatcagagaaggtggtaagacc
gtcggaacaggtcttgttacaagaattatcgaatag

DBGET integrated database retrieval system