KEGG   Kazachstania africana: KAFR_0G03260Help
Entry
KAFR_0G03260      CDS       T02487                                 

Gene name
KAFR0G03260
Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kaf  Kazachstania africana
Pathway
kaf00020  Citrate cycle (TCA cycle)
kaf00480  Glutathione metabolism
kaf01100  Metabolic pathways
kaf01110  Biosynthesis of secondary metabolites
kaf01130  Biosynthesis of antibiotics
kaf01200  Carbon metabolism
kaf01210  2-Oxocarboxylic acid metabolism
kaf01230  Biosynthesis of amino acids
kaf04146  Peroxisome
Module
kaf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kaf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KAFR_0G03260 (KAFR0G03260)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KAFR_0G03260 (KAFR0G03260)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    KAFR_0G03260 (KAFR0G03260)
Enzymes [BR:kaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KAFR_0G03260 (KAFR0G03260)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 13887337
NCBI-ProteinID: XP_003958493
UniProt: H2AYA8
LinkDB All DBs
Position
7:complement(675642..676907)
Genome map
AA seq 421 aa AA seqDB search
MMLSRRCFSTTRLLSKIKVKSPVVEMDGDEMTRIIWDKIKSKLVLPYLDLDLKYYDLSIT
NRDATNDQVTVDAANATKKYGVGIKCATITPDEARVKEFNLKKMWKSPNGTIRNILGGTV
FREPIVIPRIPRLVGGWEKPIIIGRHAHGDQYKATDLVIPGPGKLQLVYTPDGGSPAKTL
DVFNYNGGGVGMAMYNTDESIEGFAHSSFQVALNKKLNLFLATKNTILKKYDGRFKDIFQ
QIYNGQYKAKFEQLGITYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSL
GLMTSILVSPDGKTFESEAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELDG
TKDVIAFANKLEAATLDSVQEDGIMTKDLALASGKNNRSDYVNTDEFIDAVEARLKREMK
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgatgctttcaagaagatgtttctccactacaaggttactgtcaaagataaaagtcaaa
tctcccgtcgtggaaatggacggtgatgagatgactagaatcatttgggataaaattaaa
tcaaaattggttttaccttacttggacttagatttaaaatactacgatctatcaatcaca
aatcgtgatgctaccaatgatcaagttaccgtggatgcagcaaacgctactaagaaatac
ggtgtcggtatcaaatgtgctactataactccagatgaggcaagggttaaagaatttaat
ttgaagaaaatgtggaaatctccaaatggtacgataagaaacatattgggtggtacagtc
tttagagaaccgatcgttataccaagaataccaagattggttggtggttgggaaaaacca
atcatcattggtagacacgctcacggtgatcaatacaaagctaccgatcttgtcatccca
ggaccaggaaagttacaacttgtttatactccggatggcggttctccagcaaagacccta
gacgtgtttaattataatggtgggggtgtaggcatggcaatgtacaatactgacgaatct
atcgaaggatttgcacattcttcattccaagtggccttaaacaagaaattaaatctattt
ttggctactaagaatacaatattgaaaaaatatgatggtagattcaaagatattttccaa
caaatttacaatggtcaatataaagcaaaattcgaacaattaggtatcacatacgaacac
agattaatagatgatatggtggcacaaatgataaaatctaagggtggatttatcatggct
ttgaaaaattatgacggtgatgttcaatccgatattgtagcacaagggtttggttcactc
ggtctaatgacctcgatacttgtcagtccagacggcaagacttttgaaagtgaagccgcc
catggcacagtaaccagacatttcagaagacatcaaatgggagaagagacttcaaccaat
tcaattgcttccatctttgcttggtcaagagggttggccaagagaggtgaacttgacggt
acaaaggatgtcatcgcttttgccaataaattagaagccgccaccctagacagcgtgcaa
gaagatggtatcatgactaaggatttagctttagcatctggtaagaataatagatctgat
tatgttaacacagatgaatttattgatgctgtagaagcaagattaaagagagaaatgaag
ctgtaa

DBGET integrated database retrieval system