KEGG   Kazachstania africana: KAFR_0H02790Help
Entry
KAFR_0H02790      CDS       T02487                                 

Gene name
KAFR0H02790
Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
kaf  Kazachstania africana
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kaf03036]
    KAFR_0H02790 (KAFR0H02790)
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KAFR_0H02790 (KAFR0H02790)
Chromosome and associated proteins [BR:kaf03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     KAFR_0H02790 (KAFR0H02790)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl DFF40 DUF2560
Motif
Other DBs
NCBI-GeneID: 13887684
NCBI-ProteinID: XP_003958823
UniProt: H2AZD2
LinkDB All DBs
Position
8:complement(531813..533966)
Genome map
AA seq 717 aa AA seqDB search
MSQDKDPLEKFYLQFQKFVQNNPNVISAARAASQIPESAKAIVILSPYSLQHIFPREWVS
KSYKKTIVERPERLLAASMGIAAAITMYPALFTLKSSHNRLGSLHAPHVIKVHGSKWPNE
VIRLCHEADSKLREGKLEVPESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEH
ICNRAFVAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTYGVTHVVVLDFDLHHGDGTQ
DICWKRAGFKPDGNYIDEADSTGYDDFEKKMADFPKVGYFSMHDINSFPTESGYATRENI
KNASTCIMNSHDLNIWNVHLSKWSTEEDFLKLYRSKYRTLFAKADEFFKAAKLEMASMGK
PYKGLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKLAQMHCHGKVISIMEGG
YSDKAITSGVFAHLIGLQNQDWIKEWGSEQVVKEIVRGCKPTWKPYKTKRNDDVIRVWAE
EVIRLGRSMIPEFDDVIFKEKLKLEKAKHSTFDGQTISQRVTRSIAAARETGVSMNDRII
KNELNVERVPVKQLINHKAQQHKVPFVEQDLSSEDEEDNDYVYDEELNKTFNRTVEDITI
DDISRHLETLEIIQDEEENENENERMVSQNPSSSSSSRSRTTGNGQRHLQSNGMYKIPSS
TTTQHLRHSRNSRTIPTANTYQHANNNTSIATYDDSDVSMISHISTKKHTTRSGGRW
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagataaagaccccttggagaaattttatttgcaatttcaaaaattcgttcaa
aataaccccaatgtcatatctgctgcgagagctgcttctcaaataccagagtctgctaaa
gctatagttattttgtctccttactctttacagcatattttccccagagaatgggtctct
aaatcgtataagaagactatagtagagagaccagaacgtctgctagctgcttcaatgggt
atagctgcagctattacaatgtacccggctttatttactttaaaatcatcccataacaga
ctaggttccttgcatgcacctcacgtgataaaagttcacggttccaaatggcccaatgag
gttataagactatgtcacgaggcagattcaaaattaagagagggaaagctggaagttccc
gagtcttggaatgctggtgacatatatttaaattctgacacaataatggctctgaaaggg
tctattggtgccatagaaacaggtgtagactctattttcaatggtccctccccggaacat
atatgtaatagagcgtttgtcgcaattcgtcccccagggcatcattgtcacgtaggtatg
ccatctggcttttgccttttaaataatgcaaatattacgattgagtatgctgccaatact
tatggtgtcacacatgttgttgtcttagattttgatttgcatcatggtgatggaacccaa
gatatttgttggaaacgtgcaggcttcaaaccagatggtaattacattgatgaagcagat
tccacaggttatgatgattttgagaaaaaaatggctgattttcctaaagttggttatttc
tcaatgcatgatattaattctttccctacagagtctggttacgctacaagagaaaacatt
aaaaatgcttcaacctgtataatgaattctcatgatttgaatatttggaacgtgcatcta
tctaaatggtccacagaagaagattttcttaaattataccgttccaaatatagaacttta
tttgccaaagctgatgaatttttcaaggctgcaaaactagagatggcatcgatgggtaaa
ccatataaaggtttagtcctaattagttccggttttgatgcctcagaattcgaacaggtg
tcgatgcaaagacatagcgttaacgttccaacaactttctatacaatgttcactaaagat
gctttgaagttagcacagatgcattgtcatgggaaagttatctccattatggaaggtggt
tattctgacaaagcaataacatccggtgtctttgcacatcttattggtttacaaaatcag
gattggataaaagaatgggggtctgaacaagtcgttaaagaaattgttcgtggttgtaaa
cctacttggaaaccttataagaccaagagaaatgatgatgttattagagtttgggcagaa
gaagttatcagactaggtagatcaatgattccagagtttgatgatgtcattttcaaagaa
aaactcaaacttgaaaaagcaaaacactcaactttcgatggtcaaactatttctcaaaga
gtaacaaggtcaattgctgcagcaagggaaactggtgtgtcgatgaacgacagaattata
aagaatgaactcaatgtggaaagggttcctgttaaacaattgatcaatcataaggcgcag
caacataaggtaccatttgtagagcaagacctttcaagcgaggatgaagaggataacgat
tacgtatatgatgaggagttgaataaaacattcaaccgtactgtggaggatattaccatc
gatgatatttcaagacatttagaaactttagaaatcattcaagatgaggaagaaaatgaa
aacgaaaatgaaagaatggtgtcacaaaatccatcttcttcctcttcttctagatcaaga
actacaggtaacggtcaacgtcacttacaaagtaatggaatgtataaaattccttcaagt
actacgacacagcatttaagacatagtcgtaactctcgtactataccgacagctaatacg
tatcaacacgccaataataacactagtattgcgacctatgatgatagtgatgtctctatg
atatctcatatctcgacaaaaaagcacaccactagaagcggtggtagatggtag

DBGET integrated database retrieval system