KEGG   Kazachstania africana: KAFR_0H03370Help
Entry
KAFR_0H03370      CDS       T02487                                 

Gene name
KAFR0H03370
Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
kaf  Kazachstania africana
Pathway
kaf00500  Starch and sucrose metabolism
kaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KAFR_0H03370 (KAFR0H03370)
Enzymes [BR:kaf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     KAFR_0H03370 (KAFR0H03370)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 13887743
NCBI-ProteinID: XP_003958882
UniProt: H2AYH0
LinkDB All DBs
Position
8:complement(641838..643532)
Genome map
AA seq 564 aa AA seqDB search
MITNLRCKDNRKDDSISISPRSHLLKLRYYLSLSITCILLVSLIWEQVHSTDTFKSYSHQ
KFIIDNFRLDSPIQLKPISSKSITQTEFENWLDLQFGISKERLLHNIFSDNGTMVAGTSN
EHPNYYFQWTRDSAITMNTVVNEFRDDKTLLGIILNYISNAYNLQRLDNLSGKFTLEDKF
KNLGEPKYNIDNSPYDANWGRPQNDGPALRIITIVNFLNTIDNSVELNLAELIKTSKLTN
LHFNDEFDLINRILYYDLKFLILNFNQPCFDLWEEIYDVHFFTVITQLYAIKLSINLLEH
YQTTFKFIANNDEGLLNELKSTYDNIFKLLFTKDKYINSSKSFIVESPNHLDERSGLDIA
VILGSLITHPIVNNVKDILPFFTPLDSGILNTLHGLVKTMTIMYPINHSKINLNAGVALG
RYPEDIYDGIGTSEANPWFLATLTASQLILTFINGVKNSEKDIVINYDNYKFWSLIFEQD
VEKKSFEFRIPYNSQAFNQTMTHLFQFSDSFIEVAREHIDSRNGEMSEQFNKFTGFLTGA
QNLTWSYSSFMDTYKLRSIIAELV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgataacaaacttacgctgcaaggataacagaaaagatgatagtatttcaattagtccg
agatctcatttattaaaattgagatactatctatcgctatcgataacatgtatacttttg
gtttcgttaatctgggaacaagttcactccactgacacctttaagagttattcacatcaa
aagttcataattgataactttcgactggatagtcccatacaattgaaaccaatttcttca
aagagtattacacaaacagaatttgaaaattggttggatttacaatttggaatctctaag
gaaagattacttcataatatattcagtgataatggtaccatggtggcaggtacatcgaat
gaacatccgaattattatttccaatggactagagattcagcaattacaatgaataccgta
gttaatgaatttcgagacgacaaaaccctgttgggaattattcttaactatattagtaat
gcttacaacttacaaagattagacaatctctcaggtaaatttacactcgaggataaattc
aagaatttaggtgagccaaaatataatatcgataatagtccatatgatgctaattggggg
aggccccaaaatgatgggcctgcattaagaataattacaattgtaaattttctcaataca
attgataattcagtcgagttgaatttagctgaattgatcaaaacttcaaaactcactaac
ttacactttaatgacgaattcgatttaataaataggatcctatattacgatttgaaattt
ttaatattaaatttcaatcaaccatgttttgacctttgggaagaaatctatgatgtccat
tttttcacggtaattactcaattatatgctattaaattgagtatcaatttattagagcac
taccagactacattcaagtttatcgccaacaatgatgaaggattacttaatgaattgaaa
tctacttatgataatatttttaaattgttgtttactaaggacaaatacattaactcttcg
aagagtttcattgtagaatcaccaaatcatttggatgagagatcaggtttagatattgct
gtaatattgggttccttaattacacatccaattgtaaataatgtaaaggacattttgcca
tttttcacacctttagattctggaatattgaacactctacatgggctagtaaagacaatg
acaattatgtatccaattaatcatagtaagattaatttgaatgctggcgtagcattagga
agatacccagaagatatatacgatggaattggcacttcggaggcaaatccatggtttcta
gccacattaacggcttcacagttgatattgacctttataaatggtgttaagaacagtgag
aaagatattgttattaattatgataattataaattttggtcattaatcttcgaacaagac
gtcgaaaagaaatcttttgaatttagaataccatacaattctcaagcattcaaccaaaca
atgacacatttgttccaatttagtgattcatttattgaagtagcaagagaacatattgat
tcaaggaatggtgaaatgagtgaacagtttaacaaattcactggattcttgacgggtgct
caaaatttgacctggtcatactcttcgttcatggatacttacaaactcagatcaattata
gctgaattggtttaa

DBGET integrated database retrieval system