KEGG   Kazachstania africana: KAFR_0H03590Help
Entry
KAFR_0H03590      CDS       T02487                                 

Gene name
KAFR0H03590
Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
kaf  Kazachstania africana
Pathway
kaf00020  Citrate cycle (TCA cycle)
kaf00190  Oxidative phosphorylation
kaf01100  Metabolic pathways
kaf01110  Biosynthesis of secondary metabolites
kaf01130  Biosynthesis of antibiotics
kaf01200  Carbon metabolism
Module
kaf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kaf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kaf_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KAFR_0H03590 (KAFR0H03590)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KAFR_0H03590 (KAFR0H03590)
Enzymes [BR:kaf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KAFR_0H03590 (KAFR0H03590)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 13887765
NCBI-ProteinID: XP_003958904
UniProt: H2AYJ2
LinkDB All DBs
Position
8:680256..682151
Genome map
AA seq 631 aa AA seqDB search
MLSIRSSFNGVARRSFRSTSRQWRQYSTDHNSLAAKYPIIDHEYDCVVVGAGGAGLRAAF
GLAEAGFKTACVSKLFPTRSHTVAAQGGINAALGNMHPDNWKWHMYDTVKGSDWLGDQDS
IHYMTREAPKSIIELEHFGMPFSRNKEGRIYQRAFGGQSKEYGKGGQAYRTCAVADRTGH
AMLHTLYGQALNHDCNFFIEYFAMDLLTHNGEVVGVIAYNQEDGTIHRFKAHKTVIATGG
YGRAYFSCTSAHTCTGDGNAMVARAGYPLQDLEFVQFHPSGIYGSGCLITEGARGEGGFL
LNSEGERFMERYAPTAKDLASRDVVSRAITMEIRAGRGVGKEKDHIYLQLKHLPASVLKE
RLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTKYTGEALTVDEKTGEDKVIPGLL
ACGEAACVSVHGANRLGANSLLDLVVFGRAVAKTVSSSLQPGLPHKPLPDDIGKESIANL
DKLRNSNGSKSTAQIRLEMQKAMQKDVSVFRTQETLEEGVRNITNIARSFNDVCVTDKSM
IWNSDLVETLELQNLLTCATQTAISAANRKESRGAHAREDYPKRDDENWMKHTLSWQKDL
NDPVKLNYRNVIYKTLDENECPSVPPAIRSY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgataaggtctagtttcaacggtgtagcgagaagaagtttcagatccacttca
aggcagtggaggcagtacagtacagatcacaactcactggccgccaagtatcctataatt
gaccacgaatacgattgtgtagtggtaggtgcaggaggtgcaggattaagagctgcattt
ggactggcggaagcagggttcaaaactgcctgtgtatcgaaattgttcccaacaaggtcc
catacggtggcagcccaaggtggtataaatgcagctttggggaatatgcatccagataat
tggaagtggcacatgtacgatacagtaaaaggctcggattggttaggggatcaagattct
atacactatatgacaagagaggcacctaaatcaatcatagaattagagcattttggcatg
ccattttcgagaaataaagaaggaagaatctatcaaagagcatttggtggtcagtctaaa
gaatatggtaagggaggtcaagcatatagaacttgcgcggttgcggacagaacgggccat
gccatgctacacactttatatggccaagctttgaatcatgactgtaacttcttcatcgaa
tattttgcaatggatttgttgactcataatggtgaagttgtaggggttattgcatataat
caagaggatggcactattcataggttcaaggctcataaaactgtaatcgccacaggcgga
tatggtagagcttatttctcttgtacctcagcacatacctgcactggggacggtaatgca
atggtagcaagagctggttatcccttgcaggacttggaatttgttcaattccatccttca
ggtatatatggctccggctgtctaattacggagggtgctcgtggtgaaggtggattttta
ttaaattctgaaggtgaaagattcatggaacgttatgcgccaaccgcaaaggatttggct
agtagggatgttgtttctcgtgctattacaatggaaattagagcaggaagaggagtggga
aaagagaaggatcatatatacttgcaattgaagcacttaccagcttcggtactcaaggaa
aggttgccagggatttcggaaaccgcagccatttttgctggtgtagatgtaacgaaggag
cccatacctgtattaccaacggttcattataatatgggtggtattccaaccaaatatacc
ggagaagctttgaccgttgatgaaaaaactggcgaagataaggttattccaggattgctt
gcctgtggtgaggctgcatgtgtttcagtccatggtgcaaatagacttggtgctaactct
ttattagatcttgttgtatttggtcgtgctgtggcaaaaacagtatctagctctttacag
cctgggctacctcacaagccattacccgatgacattggtaaggaatcgattgccaattta
gacaaattaagaaattctaacggttctaaatccaccgctcaaatcaggttagagatgcag
aaagccatgcagaaggatgtgtccgtctttagaacccaagaaacattggaggaaggtgtc
agaaatattacaaatattgcacgttccttcaatgatgtttgcgttaccgataaatcaatg
atatggaattctgatcttgtggaaaccttggaattacagaatttgctaacatgcgctact
caaacagccatatcagccgccaataggaaagaatctcgtggtgcacatgcaagagaagat
tatccaaagagagatgatgaaaactggatgaaacatacgttatcgtggcaaaaggatttg
aatgatccggttaagttgaattatagaaatgtgatttacaaaactttagatgaaaatgaa
tgtccttcggtaccaccagccatcagatcatactag

DBGET integrated database retrieval system