KEGG   Kazachstania africana: KAFR_0J02970Help
Entry
KAFR_0J02970      CDS       T02487                                 

Gene name
KAFR0J02970
Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
kaf  Kazachstania africana
Pathway
kaf00010  Glycolysis / Gluconeogenesis
kaf00051  Fructose and mannose metabolism
kaf00052  Galactose metabolism
kaf00500  Starch and sucrose metabolism
kaf00520  Amino sugar and nucleotide sugar metabolism
kaf01100  Metabolic pathways
kaf01110  Biosynthesis of secondary metabolites
kaf01130  Biosynthesis of antibiotics
kaf01200  Carbon metabolism
Module
kaf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kaf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KAFR_0J02970 (KAFR0J02970)
   00051 Fructose and mannose metabolism
    KAFR_0J02970 (KAFR0J02970)
   00052 Galactose metabolism
    KAFR_0J02970 (KAFR0J02970)
   00500 Starch and sucrose metabolism
    KAFR_0J02970 (KAFR0J02970)
   00520 Amino sugar and nucleotide sugar metabolism
    KAFR_0J02970 (KAFR0J02970)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KAFR_0J02970 (KAFR0J02970)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kaf04131]
    KAFR_0J02970 (KAFR0J02970)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     KAFR_0J02970 (KAFR0J02970)
Membrane trafficking [BR:kaf04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    KAFR_0J02970 (KAFR0J02970)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 13884010
NCBI-ProteinID: XP_003959496
UniProt: H2B161
LinkDB All DBs
Position
10:complement(565509..566969)
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMADVPQNLLDEIHELENLFSVSNEKLQEITKHFITELDKGLSKKG
GNIPMIPGWVMEYPTGTESGDFLAIDLGGTNLRVVLIKLGGDRTFDSTQSKYKIPEEMRT
SQNRDDIFGFIAESLKAFVDEQFPQGVDKPLPLGFTFSFPASQDKINQGVLQRWTKGFDI
PNVEGHDVVPLLQEQIAKRNIPIDVVALINDTTGTLVASLYTDADTKMGVIFGTGVNGAY
YDVVSDIEKLQGRLADDIPNDSPMAINCEYGSFDNEHVVLPRNKFDLVIDEESPRPGQQA
FEKMTSGYYLGELLRLALLELHGKGLIFQNQDISKLKQAYVMDTSYPSRIEEDPFENLED
TDELLQTDLGISTSVPERKLIRHLCELIGTRAARLSVCGIAAICQKRNYASGSIACDGSV
FNRYPGFQEKAAQALRDIYGWTPGSPASYPIKLHAAEDGSGAGAAIIAALAQKRLAAGKS
VGVIGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttaggtccaaaaaagccacctgctagaaaaggttctatggctgatgtccca
caaaatctattagatgaaattcacgaattagaaaacttattcagtgtttctaacgaaaaa
ttacaagaaattaccaagcacttcatcactgaattagataaaggtctatctaagaagggt
ggtaacattccaatgattccaggttgggttatggaatacccaactggtactgaatccggt
gatttcttggccattgatttaggtggtaccaatttaagagttgtcttaatcaaattaggt
ggtgaccgtactttcgattccactcaatccaagtacaaaattccagaagaaatgagaact
tctcaaaaccgtgatgatatcttcggtttcattgctgaatctttgaaggcttttgtcgat
gaacagttcccacaaggtgttgacaagccactaccattaggtttcactttctctttccca
gcttctcaagataaaatcaaccaaggtgttttacaaagatggactaaaggtttcgacatt
ccaaacgtcgaaggccacgatgtcgttccattattacaagaacaaatcgctaagagaaac
atcccaattgatgttgttgctttaattaacgatactaccggtactttggtcgcttcctta
tacactgatgctgacactaagatgggtgttatcttcggcactggtgttaacggtgcctac
tacgatgtcgtttctgacattgaaaagttacaaggtagattagctgatgatattccaaat
gactctccaatggcaatcaactgtgaatatggttctttcgacaatgagcatgttgtttta
ccaagaaataagttcgatcttgtcattgatgaggaatctccaagaccaggtcaacaagct
ttcgaaaagatgacttccggttattacttaggtgaattactacgtttagctttacttgaa
ttacacggtaaaggattaattttccaaaaccaagatatctctaaattaaagcaagcatac
gtcatggatacctcttatccatctagaattgaagaagatccattcgaaaacttagaagac
actgatgaattattacaaacagatttaggtatctccacctccgttccagaacgtaagttg
attagacatttatgtgaattgattggtaccagagctgctagattgtccgtctgtggtatt
gctgctatctgtcaaaagagaaactacgcttctggtagtatcgcttgtgatggttctgtt
ttcaacagatacccaggcttccaagaaaaggctgcccaagctttaagagacatttacggt
tggaccccagggtcaccagcttcctacccaatcaagttgcatgctgctgaagatggttct
ggtgctggtgctgctattattgctgctttagctcaaaagagattagctgctggtaagtct
gtcggtgtcattggtgcctaa

DBGET integrated database retrieval system