KEGG   Kazachstania africana: KAFR_0K00330Help
Entry
KAFR_0K00330      CDS       T02487                                 

Gene name
KAFR0K00330
Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
kaf  Kazachstania africana
Pathway
kaf04113  Meiosis - yeast
kaf04138  Autophagy - yeast
kaf04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:kaf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    KAFR_0K00330 (KAFR0K00330)
  09143 Cell growth and death
   04113 Meiosis - yeast
    KAFR_0K00330 (KAFR0K00330)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    KAFR_0K00330 (KAFR0K00330)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kaf01001]
    KAFR_0K00330 (KAFR0K00330)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:kaf03019]
    KAFR_0K00330 (KAFR0K00330)
   03036 Chromosome and associated proteins [BR:kaf03036]
    KAFR_0K00330 (KAFR0K00330)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     KAFR_0K00330 (KAFR0K00330)
Protein kinases [BR:kaf01001]
 Serine/threonine kinases: AGC group
  PKA family
   KAFR_0K00330 (KAFR0K00330)
Messenger RNA biogenesis [BR:kaf03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     KAFR_0K00330 (KAFR0K00330)
Chromosome and associated proteins [BR:kaf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    KAFR_0K00330 (KAFR0K00330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 13886577
NCBI-ProteinID: XP_003959523
UniProt: H2B188
LinkDB All DBs
Position
11:74162..75283
Genome map
AA seq 373 aa AA seqDB search
MMETHAQYVDYLPTKEKQETSQELEDTAQQQQILYQKAMNQEQPSVLQQRSTVSKGKYTL
NDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQIEHTNDERRMLKLVEH
PFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVVLALEYLHFN
NIIYRDLKPENILLDRNGHIKITDFGFAKEVTTVTWTLCGTPDYIAPEVIATKPYNKSVD
WWSLGILIYEMLAGYTPFYDTTPMKTYEKILHGRVTYPSFFNSDVVDLLSKLITADLTRR
IGNLQNGTQEIKSHPWFSEVVWEKLLSKDIETPYEPPIVSGVGDTSLFDQYPEERLNYGI
HGEDPYEALFTDF
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgatggagacacatgcgcagtatgtagactacttgcccacgaaggaaaaacaagagacg
tcccaggaattggaagacacggctcagcagcaacagatactgtatcaaaaggcgatgaat
caagaacagccgtcggtattacagcaacgatctaccgtctctaagggtaagtatacgttg
aatgatttccagataatgagaactctggggacagggtcctttggtagagtgcatttagtt
agatctgttcacaacggtagatactatgctattaaagtattgaaaaagcaacagatcgtg
aaaatgaaacaaattgagcatacaaacgatgaaaggagaatgctaaaattggtagaacat
ccttttctaattagaatgtggggcacatttcaggattccaataatctttttatggtcatg
gattacatcgaaggaggtgaacttttttcactgctaagaaaatcgcaaagatttccaaat
cccgtggctaaattttatgctgccgaagttgtattggcgttagagtatctgcacttcaac
aatatcatctatagggatttaaaacctgaaaatatcctactggatagaaatggtcacatt
aagataactgattttggttttgctaaagaagttacgacagtgacatggactctttgtggt
actcccgattacattgcaccggaagtcattgctacaaagccttacaataaatcagttgat
tggtggtctttaggtatattaatttatgaaatgttggcaggctatacaccattttatgat
acgaccccaatgaaaacttatgaaaaaattttgcatggtagagtcacatacccatctttt
ttcaattcagatgtagtcgatttactttctaaattgattactgccgatttaacgagaaga
atcggtaatttacaaaacggaactcaggaaatcaaatcgcatccatggtttagtgaggtc
gtttgggaaaaattattaagtaaagatattgaaacaccatatgaaccccctatcgtctct
ggtgttggtgatacatcattatttgatcagtaccctgaagaaagattgaattacggtatt
cacggtgaagatccatatgaagctttatttacagatttctaa

DBGET integrated database retrieval system