KEGG   Ketobacter alkanivorans: Kalk_03895Help
Entry
Kalk_03895        CDS       T05294                                 

Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kak  Ketobacter alkanivorans
Pathway
kak00071  Fatty acid degradation
kak00280  Valine, leucine and isoleucine degradation
kak00281  Geraniol degradation
kak00310  Lysine degradation
kak00362  Benzoate degradation
kak00380  Tryptophan metabolism
kak00410  beta-Alanine metabolism
kak00640  Propanoate metabolism
kak00650  Butanoate metabolism
kak00903  Limonene and pinene degradation
kak00930  Caprolactam degradation
kak01100  Metabolic pathways
kak01110  Biosynthesis of secondary metabolites
kak01120  Microbial metabolism in diverse environments
kak01130  Biosynthesis of antibiotics
kak01200  Carbon metabolism
kak01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:kak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Kalk_03895
   00650 Butanoate metabolism
    Kalk_03895
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Kalk_03895
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Kalk_03895
   00310 Lysine degradation
    Kalk_03895
   00380 Tryptophan metabolism
    Kalk_03895
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Kalk_03895
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Kalk_03895
   00281 Geraniol degradation
    Kalk_03895
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Kalk_03895
   00930 Caprolactam degradation
    Kalk_03895
Enzymes [BR:kak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Kalk_03895
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Kalk_03895
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Kalk_03895
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Kalk_03895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AUM11612
UniProt: A0A2K9LH54
LinkDB All DBs
Position
complement(945809..947956)
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAVTVKSLEDGIVELNFDLEGESVNKFNRQTVEELGAAAEAMKADSSIKGMIVTS
AKSVFIVGADITEFGALFTLSEEEIAGWCIKSNQAFNAIEDLPFPTVTAMNGIALGGGLE
MCLATDFRVMSTEAQCGLPEVKLGLYPGFGGTVRMPRVIGVDNAVEWIAAGGQHKPEKAL
KDGVVDAVVAPEKLRDAALSLVKDCIAGKIDYKAKRQEKLDPLRLPPMENMMAFQTCSAM
VMQQAGRNYPAPMAAVQTMQQHAGMTRDKALEVEAKGFAKVATTPVASSLIGLFMNDQIL
KKVASKWEKQAKPVNLAAVLGAGIMGGGIAFQSASKGTPIIMKDINEPALELGMSEATKL
LAKRVDRKKMQPAKMGQVLSSIRPTLNYGDFQGVDIVVEAVVENVKIKQSVLADVEKNVK
DGTILASNTSTISITKLAEALEKPENFVGMHFFNPVHMMPLVEVIRGEKSSEEAVATTVA
YAKKMGKTPVVVNDCPGFLVNRVLFPYFGGFGMMLRDGADFQKIDKVMERFGWPMGPAYL
MDVVGIDTGVHAAEVMAEGFPDRMKHDYKDASEVMFENKRFGQKNGIGFYKYETDKKGKP
KKVVDEATYELIKPHVGASKDFEDQEIIDRLMIPMCLELVRCLEENIVSSVPDADMALIM
GIGFPPFRGGALKYIDSIGVKAFVELCDKYKDLGGLYEPTAKLREMAANGESFYQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaggaaaagccgtaacggtcaaatcgttagaagacggcatcgtagaatta
aatttcgatctggaaggcgagtcggttaacaaatttaatcgccagacagtcgaagagttg
ggtgctgctgctgaagcaatgaaagcggacagctctattaaaggtatgattgttaccagt
gcgaagtctgtatttatcgtgggtgcggacatcaccgaatttggtgcattgtttaccctc
tcggaagaagaaatcgccggctggtgtattaagtcaaaccaagccttcaacgccattgaa
gacctgcctttcccaacggtcaccgccatgaacggtatcgctttgggtggtggtctggaa
atgtgtctggctaccgattttcgtgttatgtccactgaggctcaatgtggcctgccagaa
gtgaaactgggtttgtatccaggttttggtggcactgtgcgcatgcctcgggttatcggt
gttgataacgccgttgagtggattgccgccggtggtcagcataagcctgagaaagcattg
aaagacggtgttgtggatgccgttgttgctcctgagaaactgcgcgatgcagcgttgtct
ctggttaaggactgtatcgctggcaagatcgattacaaagccaagcgccaggagaaactg
gatcctctgcgtctgccacccatggaaaacatgatggcgttccagacttgctccgcaatg
gttatgcagcaagctggccgtaactatcctgcaccaatggcagcggttcaaaccatgcag
cagcatgctggcatgacccgtgacaaggcgctggaagtggaagctaaaggcttcgctaaa
gtcgcgaccaccccggttgccagctcgctgatcggtttgttcatgaacgatcagatcctc
aagaaagttgctagcaagtgggaaaagcaagccaagccggtgaatctggctgcggtgctg
ggtgcaggcattatgggcggcggtatcgcgttccagtctgcctctaaaggaacgcccatc
atcatgaaggacatcaacgagccagctttggagctgggtatgtccgaagcgaccaagttg
ttggccaagcgtgttgatcgcaagaaaatgcagcccgctaaaatgggtcaggttctttca
tccatacgcccaaccctgaactacggtgatttccaaggtgtggacatcgtagtagaggcc
gtcgttgagaatgtgaagatcaagcaaagcgtgctggctgatgttgagaagaacgtgaaa
gacggcactatcctggcgtccaacacttctaccatctcgatcactaagctggcagaagcg
ctggaaaaaccagaaaatttcgtcggtatgcacttcttcaacccagtacacatgatgccg
ttggttgaagttattcgtggcgagaaatcttctgaagaagcggttgctaccacggtagcc
tatgccaaaaagatgggtaaaacccccgttgttgtgaatgactgcccaggcttcctggtg
aatcgcgtgttgttcccatacttcggtggcttcggcatgatgctgcgggacggcgctgat
ttccagaaaatcgataaggttatggaacgtttcggctggccgatggggcctgcttacctg
atggatgttgttggcatcgatacgggtgtgcatgcggctgaagttatggctgagggcttc
cctgaccgaatgaagcatgattacaaagatgcgtctgaagtaatgtttgagaacaagcgc
ttcggccaaaagaacggcatcggtttctataaatacgaaactgacaagaagggcaaaccc
aagaaagtggttgatgaagcgacctatgagctgattaaacctcatgttggtgccagtaag
gacttcgaagatcaggaaatcattgatcgtctgatgattccaatgtgtctggagttggtg
cgttgtctggaagagaacattgtgtcttccgtaccagacgccgatatggctttgattatg
ggtatcggcttccctccattccgtggtggtgcgctgaaatacattgattccattggtgtg
aaagcgtttgttgagctgtgcgataagtacaaggatcttggtggtctgtacgaacccact
gcaaaactgcgtgaaatggccgccaacggcgaatctttctaccaataa

DBGET integrated database retrieval system