KEGG   Ketobacter alkanivorans: Kalk_15290Help
Entry
Kalk_15290        CDS       T05294                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kak  Ketobacter alkanivorans
Brite
KEGG Orthology (KO) [BR:kak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Kalk_15290
Enzymes [BR:kak01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Kalk_15290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 NAD_binding_7 AlaDh_PNT_C Glutaredoxin FMO-like K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AUM13701
UniProt: A0A2K9LNI6
LinkDB All DBs
Position
3588931..3590493
Genome map
AA seq 520 aa AA seqDB search
MLDDNLKSQLKTYLTNVKKDIELVASVDDSAKSKEMLDLLTGIVALTDKITLKEVRDDAE
RKPSFRVNRPGEDINVRFAGLPMGHEFTSLVLALLHVGGHPPKEEARLLEQIVQLEGEYE
FETYISLSCHNCPVVVQALNLMAALNPNVKHTMIDGALFQDEVDSRQVMAVPTVYLNGQE
FGAGRMTLEEILTKADTKASERQAKELSEKAPYDLLVVGGGPAGASAAIYAARKGIRTGI
VADRFGGQVMDTVSIENFISVQETEGPKLVAQLEQHVRQYEVDIMTNQKAVGMVPGSSTE
VQLENGATLKSKAVLIATGASWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVAHVTLIEFDDKLRADAVLQKKLNSLPNVTIVVSALTKEVLGDGNKV
VGLNYEDRTNGEMHKVDLEGIFVQIGLLPNTAWAKGVIELSPRGEIVVDERGQTSVPGIF
AAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRSSVQADS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgacaatttaaagagccaattaaaaacctatttaaccaatgtgaagaaagat
atcgagctggtggcttcggttgacgattccgccaagtctaaggaaatgctcgatctgctg
actggcattgtggcgctgactgacaagattacactgaaagaagtgcgtgacgacgctgag
cgtaagccttcgttccgtgtgaatcgtccgggtgaagacatcaatgtgcgctttgccggt
ttgcccatggggcacgaatttacatcgctggtgctggcgttattgcacgttggcggacac
ccgcccaaagaagaagctcgcttgcttgaacagatcgttcagttagaaggtgagtatgaa
tttgaaacctatatatcgttgtcttgccacaactgcccggtggtggttcaggcgcttaac
ctgatggctgccctgaaccccaatgttaagcacaccatgattgatggtgcgctgtttcag
gatgaggtagacagtcgtcaggtcatggcggtaccgacggtctatctgaatggccaggaa
tttggcgccggtcgtatgaccctggaagaaatcctcaccaaggcagacaccaaagccagt
gagcgacaggccaaagaactgagtgagaaagccccctatgatctgttggtggtgggaggc
ggcccggcgggtgcttctgcagccatctatgcagcgcgtaaaggtattcgcacgggtatt
gtggccgatcggtttggtggacaagtgatggatacggtatccatcgaaaactttatttcg
gtacaagaaaccgaagggccaaaactggtggcacagcttgaacagcatgtgcgtcagtac
gaagtggatatcatgaccaatcaaaaagcggttggtatggtgcccggctccagtaccgag
gtgcagttggaaaacggcgccacgttgaaaagcaaggcggttttgattgccacaggtgcc
agctggcgggagatgaacgtacccggtgagcaagagtaccgaggtaaaggtgttgcctat
tgcccgcactgcgatggcccactgtttaagggtaagcgagtggcggttattggtggcggt
aactccggtgtggaggctgcaattgatctggccggaatcgttgcccatgtgaccttgatt
gaatttgatgacaagctgcgtgcggatgcggttttacagaaaaagcttaacagcttgccg
aacgtaaccattgttgtgtctgcgctgaccaaagaagtgttgggagatggcaacaaggtg
gttgggcttaactacgaagatcgaaccaacggcgaaatgcacaaagttgatctggaaggt
atctttgtacagattgggctgttgccgaatactgcctgggccaagggggtgatcgagctg
tcacctcgaggtgagattgtggtggatgaacgtggccagacctcagtgcctggtatattc
gcagccggtgatgttacaacggttccgtataagcagatcatcattgccatgggtgaaggt
gcaaaggcctctctgggtgcttttgattatctgatccgatcctcggtacaagccgacagc
tag

DBGET integrated database retrieval system