KEGG   Kutzneria albida: KALB_1483Help
Entry
KALB_1483         CDS       T03039                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
kal  Kutzneria albida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C Met_asp_mut_E KAsynt_C_assoc PP-binding adh_short Thiolase_N Epimerase Polysacc_synt_2 GDP_Man_Dehyd NmrA Shikimate_DH ACP_syn_III NAD_binding_10 RmlD_sub_bind Secretin_N
Motif
Other DBs
NCBI-ProteinID: AHH94856
UniProt: W5W2X4
LinkDB All DBs
Position
1606807..1623675
Genome map
AA seq 5622 aa AA seqDB search
MTAAELVTGGFGEFVRRAAQSGRLVVQPRMGMSDPAAMRAGLLSTKDARATTVGTITLDS
YTRVGELHAVETALRQGIGLNGYPIVSHPEATTRSVLDGVADEAFPVQVRHGSAVPLDIF
AAMMRAGLTASEGGPVSYCLPYGRTPLYDSLRNWERSTELFASLRSAQPHLESFGGCMMG
QLCPPSQLVAISALEALFFHQHGMRCVSASYAQGSNLAQDSEGVFALRRLCAELLPGVRW
HVVVYAHMGVYPTTPEGAYLLLGQAAELARSTGCERLIVKTVAESLRIPTVAENVAALEH
AGAVAERTPLLDKDLVNADTQTYAEARAFVDAVLDLDEDVGRALFLAFRRGYLDVPFCLH
PDNMGRSRSYLDTDGTLRWSELGSMPLGGIVRTTSARPMGSSDLLRSLSFVRTKFDTQAL
MPSTNSQPVLLADQWSAPMSESEDLVAGAELTARLHTLSAPEQLRALVDLVAGAALAVLR
GIRPDAPAALDPDRALRDAGFDSLSTVELRARLVAETGLDLPVTVAFDHPTATALARYLR
AELLGLSEEVAPVTAALAPSDDPIAVVGIGCRYPGGADSPERFWQLLVEERHVISPFPDD
RGWDLDSLFDPDPGQPGKTYAREGGFLAEAGEFDAEFFGISPREAVAMDPQQRVVLETAW
EALERAGIDPATLRGSQSGVFIGAEPQEYGPRLHEAPEGLDGYLLTGNAPSVVSGRVAYT
LGLEGPTLTVDTACSGSLVALHLAVQSLRQGECSLALAGGVAIMGSPGVFTSFSRQRGLA
ADGRCKAFASAADGTGFAEGAGVFVLERLSDAQRNGHTVLALLRGSAINQDGASNGLTAP
NGPSQQRVIRQALANAGLTAQQVQVVEAHGTGTRLGDPIEAQALLATYGRDREQPLLLGS
VKSNIGHTQAAAGVAGVLKVIMAMRRGVLPRTLHVDAPTPHVDWSVGAVELATETGPWPE
GVRRAGVSSFGVSGTNAHVIVEQAPQSEQDGQAVAPAVLPVVLSARTEEALRAQARQLAE
ALPREEVTDFTYSLATSRSTLERRAVLLGGDRDEVVRELRALAEGTRASGTAVPGGLAVL
FTGQGSQRLAMGRELCEAFPVFADALVEACGYLDLHLDRPLLDVLFGEDADLLDQTGYAQ
PALFAVEVALYRLVSSWGIRPDHLAGHSIGELAAAHVAGVLTLADAALLVCARGRLMQAL
PTGGAMVAVRATEQEVLPLLTDGVSIAAVNGPNSVVLSGIEESVLAVASQFGKSRRLRTS
HAFHSALMEPMLAEFLRIARVLTYSPPTIPIASSGDVTSPEYWVAHVRDAVRFGDRVSEL
VDQGVTTFLELGPDAVLSAMGPESVADEADVAFVPALRRDHAEAREAVAALAQVHVRTGR
VDWAGYFAGTGARRVELPTYPFQRRRYWLPAGSSTVDAAGFGQVAADHPLLGAVLGLAAG
DGVVLTGRVSLRSHPWLADHVLSGSVLFPGTAFVELAVQAGDHVGCDLVEELTLESPLVL
PSEGSVALQVVVGGEQSGRRTVDLYSGGGDGRWVRHATGLLGRTETAVSFDLTVWPPQGS
RAIDISALYEDMAGQGYGYGPVFRGLRAVWRRGAEVFAEVALPEQEKPGAFALHPALLDA
VLHATDFAAEVPPGPEIRLPFAWTGVSVHSTGAAALRVRITATGPEAVSLELADPSGAPV
ASVESFVVRAVSPEQLRVTERGGSLYEVRWQPITPQPAELPADVQLVRISSDAQDVPEAV
RQAVGQALEQVQGSAPTVLITRDNLSSAPVWGLVRSAQAEQPGRFVLVELDEDPASEALL
PAAIASGEPELALRAGQVLVPRLAPVDQSTQDGEPFGPDSTVLITGGTGGLGGLVARHLV
AQYGVRQLVLTSRRGMDAPGAAELCAELDATVTVLACDVADRGALADLLAAHPVTAVVHA
AGVLDDGLIGSLTPERVDTVLRPKADAAWYLHELTRELDLTAFVLFSSAAGFVDGAGQGN
YAAANVFLNALAEHRHAEGLPATSLAWGLWADNAGMGANLDSLTLQRISRLGLDPLTAAE
SLALFDLAVRSGAPVTLPTRVDTRALLARADGVPAILRGLVRTPSRRTASGAGEVTFAHR
LAQLPPAERDRTLLELIRGKVAEVLGHDSAAAIDPGRAFTELGFDSLAAVELRNRLNTAT
GLRLPATLTFDYPTSTALTGHIAEALFGAERRQPARTDLVAASEEPIAIVGIACRYPGGI
GSPEDLWRVVAEGVDVVSDFPVDRGWDVADLYDPVPGMPGKTYAREGGFLHQAGDFDPDF
FGISPREATAMDPQQRLLLETAWEVVERAGIDPISLRGSRTGVFAGVMYHDWATRLGEVA
EDLAGYLGNGSLASVVSGRIAYALGLEGPAVTVDTACSSSLVALHWAIQALRSGECSLAL
AGGVTVMSTPDTFVDFSRQRGMAADGRCKSFAEAADGTGWSEGVGLLLVERLSDARRNGH
EVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIAQALASAGLHPSEVDLVEGHGTGTTLGD
PIEVQALLATYGQDRDLPLWLGSIKSNMGHTQAAAGVAGIIKAVMAMRNGVLPRTLHVDE
PSHQVEWSAGNVRLLAEEQPWPELDRPRRAAVSSFGISGTNAHVILEQVPVLEPSARELE
PRVVPWIVSGRTPEALAAQVARMSDVDADPLDVAYSLATTRAALPHRAAVAGTDRAELLR
GLADAQGAAAESGAVAFLFTGQGAQRVGMGHELYEAFPVFAQAWDAVAAHLGDALRVDDE
QLLNQTGYAQPALFAHEVALYRLLESWGVTPDFVAGHSVGELAAAHVAGVLSLTDACTLV
SARGRLMQALPTGGAMVAVQAGEHEIPSRDGVGIAAVNGPSSVVISGDEAGVLAIRAEFE
AMGRRTSRLRVSHAFHSPLMEPMLAEFARVAEGLSFAAPSIPMMGQVDSPEYWVRHVREA
VRFHDEIRALEAHGVTRFVEIGPDGVLTGMAQDCVESELAACIALQRKDRPQEHELVSGL
AKAFSHGVHVDWAAFFAGRGARRVDLPTYAFQHRRYWINATAAHGDVSAVGQVAINHPLL
GAAVSTPDSGGVVLTGRLSAQTQTWLADHEVRGSILFPGTGFVELAVQAGDQIGCGVVEE
LTIGAPLVVPARGGVAVQVVVTEDRQFSVYSGGEGTWTRHATGFLAEADTAQAFDLTTWP
PAGATPVEIGDTYRELAEQGYGYGPVFQGLRAVWRRGDEVFAEVALPEGSEADKYAMHPA
LLDATLHAMNFGEFLEPAKDEEITLPFAWRGVSLLAAGAAALRVRMASAGTDAVTIQVAD
AAGAPVASVESLLVRAMSAKTTSIASDALFRVDWIPVAAGACTSTELDLPGAVVVPMITE
PTGDLAADTHAATQRALSLVQNWLAGESERLVVLTKGAMSARGEAVTDLPAAAVWGLLRA
AQAEEPDRITLLDVDEHGLPEQAVLAAIESGEPQLAVRGGEVFAPRLTRTALAETPTAEL
DGTVLITGGTGSLGALVARHLVAQYGVRHLVLTSRRGSDAPGAAELCAELSELGATATVV
ACDVADRAALQAVLADVPAEHPLVGVVHTAGTLADSTIGAITAEQLDSVLRPKVDAAWHL
HELTKDLDLALFVLFSSSAGVVDGAGQGNYAAANTFLDALAQHRRANGLPGVSLAWGLWN
QVGGMSGQLTDADLARLERSGILGITPEQGLDLFDAALSSDEPLLVPIRLNTTALRSRSA
LPSVLRGLVRTRSRRVVDASLTTGGSTLAQRLAALGEPERVQLLLDLVGTHVATVLGHEQ
AAAIDPRRAFRELGFDSLASVELRNRLNSATSLRLPATLVFDYPTPAALAEHIGDRLLGA
ESPVSAAVAVKSDVDEDPIVIVSMSCRFPGGVSSPEQLWEVVASGTDAVTAMPTNRGWDV
DGVYDPEPGKFGKTYTRHSGFLHEATDFDAEFFGISPREALAMDPQQRLLLETSWEVFER
AGIDPSSLRGSRTGVFAGVLQTDYASRLTQVPEDVEGYLTNGNMGSIASGRIAYVLGLEG
PALTIDTACSASLVAMHMAAQSLRQGECSLALTGGVTVMSTPDLLVDFSRQRGLSPDGRC
KAFAEAADGTGFAEGVGMLLLERLSDARRNGHPVLAVIKGSAINQDGASNGLTAPNGPSQ
QRVLSQALANAGLSAAEVDVVEAHGTGTTLGDPIEAQALLATYGQDRTRPLWLGSVKSNI
GHTQGAAGAAGVIKMVMAMRHATLPKTLHVDTPSTKVDWSAGAIELLTEARPWEVNGHPR
RAGVSSFGISGTNAHLIIEQAPDPVATEVQSTVHSSVPLVLSGRTETALRAQAARLADFL
RAEPTVNLADVCFSLGTTRAALEHRAVVVGGDHESVLAGLAALEGWESSTDLVQGKASGG
SRLVFVFPGQGSQWVGMAAELLEQSPVFAERLAECSAALSSFVDWNLLDVIRGAEGTPPF
ERVDVVQPALWAVMVSLAAVWQSLGVRPAAVIGHSQGEIAAACVAGALSIEDAARVVALR
SKAIGEALAGRGGMVSVALPAEEVAGRLDEWGGQLSLAAVNGANSVVVSGTPEALDQLMS
QFGAEGVRVKKIAVDYASHSAQVETIRDRLRTDLGAITPRTGQVPFYSTVTSQWVDSVAL
DAEYWYENLRRTVQFDEAVRTLAGEGFGGFVESSPHPVLTIGIQETLDVLGRDAVVTGTL
RREEGGPHRLCLSLAELHVRGIAVDWSALLPNARRVDLPTYAFQRKRYWLDSGTTVADAS
GFGQVAAEHPLLGAVVPLPESDGVVLTGRLSLHSHPWLADHAVNGVAVFPGTGFVELAIR
AGDQVGCGRVEELTLEAPLVLPEQGAIGVQVSLSAPDPEGRRALNVYSSAVDESWTRHAT
GLLAPAVQVDAHDLTVWPPEGASLITVDEPYRQLAERGYGYGPAFQGLRTVWRRGAEVFA
EVTLPATAEAAQFGLHPALLDAALHADTLFEDETRTVLPFAWNGVTLHAAGASALRVRLL
RDESGNISVDAADLTGAPVATVSSLAVRVVSDAQLGSARTTGADSLLRVEWTPITGSATE
PTGTWATVGESVPDLDAAAGADVVVLPVRADSSDVPAAAHAATNRVLTSVQTVLSDERFA
TATLLVLTNGAVCATEDEDVSDLASAAVWGLIRAAQEENPDRFVLVDAESPTSQQLSAVL
ASGEPQVAIRGDALLAPRLAWAQGRAPADDWDAQSTVLITGATGTLGRHFARHLVERGVR
HLLLVSRSGGRFDELTELGAHVTVAACDAADREALQRVLAAVPAEHPLSAVVHTAGVLDD
ATIASLTPEQVEAVLRPKVDAAWNLHELTKDLTRFVLFSSAAGTFGGAGQGNYAAANVFL
DALAAHRRAQGLAATSLAWGFWAERSTMTGQLTEADVQRMTSAGVQPLSTEHGLRLFDLA
LGGADPVLLPIQLDTTVLREGEVPAILRGLVRPPARRAVQVIEQDTELSLAERLTALSAP
ERERLVLDLVRGHIATVLRHEGAAAIEPNREFAELGFDSLSALELRNRLSGMAGVRLPAT
LVFDYPSPAAVARHLLAELVDEEELAMSSLDADLARLEAALAGVTPDDAQHDRIAARLRA
LTTRWVESFGRAEQPVDDGAQLRSATADELFSILDGELEAQN
NT seq 16869 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcagccgagctggtcaccggggggttcggcgagttcgtgcgccgggccgcccag
tccgggcggttggtggtgcagccgaggatgggcatgtccgacccggccgcgatgcgcgcc
gggctgctgtccaccaaggacgcgcgggccaccacggtcggcacgatcaccctggacagc
tacaccagggtcggcgagctgcacgcggtggagaccgcgctgcgccaggggatcgggctc
aacggctacccgatcgtcagccacccggaggccaccacccgctcggtgctcgacggggtc
gctgacgaggcgttcccggtgcaggttcggcacggatccgctgtgccgctggacatcttc
gccgcgatgatgcgcgcgggcctgaccgccagcgagggcgggccggtgtcctactgcctg
ccctacggccggaccccgctgtacgactcgctacgcaactgggagcggtccaccgagctg
ttcgcgagcctgcgctcggcccagccgcacctggagagcttcggcggctgcatgatgggg
cagctctgcccgccgagccagctcgtcgcgatcagcgccctggaggcgttgttcttccac
cagcacgggatgcgctgcgtctcggccagctacgcacagggttccaacctggcccaggac
agcgagggcgtgttcgcgctgcgcaggctgtgcgcggaactgctgcccggggtgcgctgg
cacgtggtggtctacgcgcacatgggcgtctacccgaccacgccggagggcgcgtacctg
ctgctggggcaggccgccgagctggccaggtccaccggctgcgaacggctgatcgtcaag
accgtggccgagtccctgcgcatccccacggtggcggagaacgtggccgcgctggagcac
gccggcgccgtggccgagcgaacccccttgctggacaaggacttggtcaacgcggacacg
cagacctacgccgaggcgagggcgttcgtggacgcggtgctcgacctggacgaggacgta
ggccgcgccctgttcctggcgttccgccgcggttacctggacgtgcccttctgcctgcac
ccggacaacatgggccgcagtcgcagctacctggacaccgacgggacgctgcgctggtcg
gagctcggctcgatgccactgggcggcatcgtgcgcaccacctccgcccgcccgatgggc
tccagcgatctgctgcggtcgctgtccttcgtgcggaccaagttcgacacccaagccctg
atgccaagcaccaactcgcagccagttctcctggcggaccagtggagcgcgccgatgagt
gagtccgaagacctcgtggccggagccgagctgaccgcccggctgcacaccctctcggcg
cccgagcagctgcgggcactggtggacctggtcgccggtgccgccctcgcggtgctgcgc
gggatccgtcccgacgcgcccgccgcgctcgaccccgaccgggcgctgcgcgacgccggg
ttcgactcactgtccactgtggagctccgcgcgaggttggtcgcggagaccgggctggac
ctgccggtgaccgtggccttcgaccacccgaccgccaccgcgctggcccgctacctgcgc
gcggaactgctcgggctgtccgaggaggtcgcgccggtgaccgccgcgctcgcgccctcg
gacgacccgatcgccgtggtcggcatcggctgccgctacccgggcggggccgactccccc
gagcggttctggcagctgctcgtcgaggagcggcacgtgatctcgccgttcccggacgac
cgcggctgggacctggactcgctgttcgacccggaccccgggcagccgggcaagacctac
gcccgcgagggtggattcctcgccgaggcgggggagttcgacgcggagttcttcgggatc
tccccgcgcgaggccgtggccatggacccccagcagcgcgtggtgctggaaaccgcctgg
gaggcactggaacgcgcgggcatcgacccggccacgttgcgcggcagccagtccggggtg
ttcatcggcgccgaaccccaggagtacggcccgcgcctgcacgaggcgccggagggcctg
gacggctacctgctcaccggcaacgcgccgagcgtggtgtccggccgggtcgcctacaca
ctggggctggagggcccgacgctgaccgtggacacggcctgctccggttcgctggtggcg
ttgcacctggccgtgcagtccctgcggcagggcgagtgctcgctcgcgctcgccggtggc
gtggcgatcatgggcagtcccggggtgttcacctcgttcagccgccagcgcgggctggcc
gccgacggccggtgcaaggcgttcgcctcggcggccgacggaaccgggttcgccgagggc
gcgggcgttttcgtgctggagcggctgtcggacgcgcagcgcaacgggcacaccgtgctg
gcgctgctgcgcggctcggcgatcaaccaggacggcgcgtccaacgggctgaccgccccg
aacgggccgtcccagcagcgggtgatccggcaggcgctggccaacgcggggctgaccgcc
cagcaggtgcaggtcgtggaggcgcacggcaccgggacccggctcggcgacccgatcgag
gcccaggccctgctggccacctacggccgggaccgggagcagccgctgctgctgggttcg
gtcaagtccaacatcgggcacacccaggccgccgccggtgtcgcgggcgtgttgaaggtg
atcatggctatgcggcggggagttctgccgcgcaccctgcacgtggacgcgccgaccccg
cacgtggactggtcggtgggcgcggtggaactggccaccgagaccgggccctggccggag
ggcgtgcgccgggccggagtctcctcgttcggggtcagtgggaccaatgcgcacgtcatc
gtggagcaggctccacagtccgaacaggacggacaggccgtagcgccggccgtgctgccc
gtcgtgctgtcggcccgcaccgaggaggcattgcgcgcgcaggcccgccaactggccgag
gccctgccgcgcgaggaggtcaccgacttcacctactcgctggcgacttcacggtccaca
ttggagcgtcgcgcggtgctgctgggcggtgaccgcgacgaggtggtgcgcgagctgcgc
gccctcgccgagggtacccgggcctcgggcaccgccgtgccgggcggcctggcggtgttg
ttcaccggtcagggcagccagcggctggcgatgggacgcgagctgtgcgaggccttcccg
gtgttcgccgacgccctggtcgaggcctgcggctacctcgacctgcacctggaccgtccg
ctgctggacgtgctcttcggcgaggacgcggacctgctcgaccagaccggttacgcccag
cccgcgctgttcgcggtcgaggtggccctgtaccggctcgtcagctcgtgggggatccgc
cccgaccacctggccgggcactcgatcggcgagttggccgcggcgcacgtcgctggggtg
ctcacgctggcggacgcggccctgctggtctgcgcccgtggccgtctcatgcaggcgctg
cccaccggtggcgccatggtcgcggtgcgcgcgaccgaacaggaagtgctgccgctgctc
accgacggggtgagcatcgccgcggtcaacggcccgaactccgttgtgctgtccgggatc
gaggagtccgtgctggccgtcgcgagccagttcggcaagagtaggcgcctgcgtacctcg
cacgcgttccactccgcgctgatggagccgatgctggcggagttcctgcgcatcgcccgg
gtgctgacctactcgccgcccacgatccccatcgccagcagcggggacgtgacctccccg
gagtactgggtcgcgcacgtgcgcgacgcggtccggttcggggaccgggtgagcgagctg
gtcgaccagggcgtgaccaccttcctggagctgggaccggacgccgtgctctcggccatg
ggcccggagtccgtcgccgacgaggccgatgtcgccttcgtgcccgcactgcgccgtgac
cacgcggaagcccgtgaggccgttgccgccctcgcccaggtgcacgtccgcaccgggcgc
gtggactgggccgggtacttcgccggtaccggggcgcggcgtgtcgagttgcccacctac
ccgttccagcgccgtcgttactggctgcccgccggttcgtccacggtggacgccgctggc
ttcggccaggtcgccgcggaccacccgctgctgggcgcggtcctcggcctggccgccggg
gacggggtggtcctgacgggacgcgtgtccctgcggtcccacccgtggctggccgaccac
gtgctgtccggctcggtcctgttccccggcacggccttcgtggaactggccgtgcaggcc
ggtgaccacgtgggctgcgacctggtcgaggaactgaccctggagagcccgctcgtgctg
ccgtccgagggcagcgtcgcgctccaggtcgtggtcggtggcgagcagtccggccgccgc
acggtcgacctctactccggcgggggcgacggccgatgggtccgtcatgcgaccggcctg
ctcgggcgaactgagaccgcagtctcatttgacctgacggtgtggcccccgcagggctcg
cgggccatcgacatctctgcgctgtacgaggacatggccgggcagggctacggctacggg
ccggtcttccgcgggctgcgcgccgtgtggcggcgcggggcggaggtcttcgccgaggtg
gccctgcccgagcaggagaagcccggcgccttcgcactgcaccccgccctgctcgacgcc
gtgctgcacgccaccgacttcgccgccgaggtgccgcccggccccgagatccggctgccc
ttcgcctggaccggtgtgtcggtgcactccaccggcgccgccgcgctccgcgtgcggatc
accgcgaccgggccggaggcggtgtccctggaactcgcggacccgagcggggcgccggtc
gcctcggtggagtccttcgtggtgcgcgccgtcagccccgagcaactgcgtgtcaccgag
cgcggcggctccctgtacgaggtccgctggcagcccatcaccccgcagcccgccgagctg
cccgctgacgtgcaactcgtgcggatctcgtcggatgcccaggacgtgcccgaggcggtg
cggcaggccgtgggccaggcgctggagcaggtccagggctcggcgccaactgtcctgatc
acccgcgacaacctgtccagtgccccggtctggggcctggtccgctccgcgcaggccgag
cagccgggccggttcgtgttggtcgaactggacgaggaccccgcatcggaggccctgctg
cccgcggccatcgccagtggcgagcccgaactcgccctgcgcgcaggccaagtcctcgta
ccgcgcctcgcgccggtcgatcagtccacacaggacggcgagcccttcggcccggacagc
acggtgttgatcaccggcggcacgggcggcctcggcggcctggtggcccgtcacctcgtt
gcgcagtacggggttcggcagctcgtgctgaccagccgccgcggcatggacgcgcccggt
gcggccgagctgtgcgccgaactggacgcgaccgtcacggtgctcgcctgcgacgtggca
gaccgcggcgcgctggccgacctgctcgccgcacaccccgtgaccgctgtggtgcacgcc
gccggtgtcctggacgacgggctgatcggctcgctcaccccggaacgggtcgacaccgtg
ctgcggcccaaggccgacgccgcctggtacctgcacgagctgacccgcgagctggacctg
actgccttcgtgctgttctcttcggcggccgggttcgttgacggcgcagggcagggcaac
tacgccgccgccaacgtcttcctgaacgcgctcgccgagcaccggcacgccgagggcttg
cccgccacctcgctggcctggggcctgtgggccgacaacgcgggcatgggcgccaacctc
gactcccttaccctgcaacgaatctcccgcctcggcctggacccgttgaccgccgcggaa
agcctcgcgctgttcgacctggcggtccgctccggcgcacccgtcacgctgccaacccgc
gtggatacccgcgccctgctggcccgcgccgacggcgtgcccgcgatcctgcgcgggctc
gtccgcaccccgtcgcggcgcacggcttcgggcgcgggcgaggtgaccttcgcgcaccgg
ctggcccagttgccgcccgcggaacgggatcggacgctgctcgagctgatccgcggcaag
gtcgccgaggtgctcggccacgacagcgccgccgcgatcgaccccggccgggcgttcacc
gagctgggcttcgactcgcttgccgcggtggagctgcgcaaccggctcaacaccgcgacc
ggactgcggctgcccgcgaccctgaccttcgactacccaacctccaccgcgctgaccggg
cacatcgccgaggccctgttcggtgccgagcgccgtcagcccgcgcggaccgacctcgtc
gccgccagcgaggaaccgatcgccatcgtgggcatcgcgtgccgctaccccggcggcatc
ggttcgcccgaggacctgtggcgggtcgtggccgagggcgtggacgtggtctcggacttc
cccgtcgaccgcggctgggacgtggcggatctgtacgacccggtgcccggcatgcccggc
aagacctacgcccgcgagggcggattcctccaccaggcgggggacttcgacccggacttc
ttcggcatcagcccgcgtgaggcgaccgccatggacccccagcagcggctcctgttggaa
accgcctgggaggtcgtcgaacgcgcgggcatcgacccgatctccttgcgcggcagccga
actggcgtgttcgccggggtcatgtaccacgactgggccacccgcctcggtgaggtcgcc
gaggacctcgccgggtacctcggcaacggcagcctcgccagcgtcgtgtccgggcgcatc
gcctacgcgctgggcctggaaggccccgcggtcacggtcgatacggcttgttcctcctcg
ctggtcgcactgcactgggcgatccaggcgctgcggtcgggggagtgctcgctcgcactg
gccggtggcgtcaccgtgatgtccacaccggacacattcgtggacttctcgcgccaacgg
ggcatggccgccgacgggcggtgcaagtccttcgcggaggccgccgacggcacgggctgg
tcggagggcgtgggcctgctgctggtggagcggctgtccgacgcgcggcgcaacgggcac
gaggtgctggccgtcgtgcggggcagcgcggtcaaccaggacggcgcctccaacggcctg
accgcgccgaacggaccttcccagcagcgggtcatcgcccaggcgctggcctccgccgga
ctgcatccgtccgaagtggacctggtcgagggacacggcaccggcaccacactgggtgat
ccgatcgaggtgcaggcactgctggccacctacggccaggaccgcgacctgccgctgtgg
ctggggtcgatcaagtcgaacatgggccacacccaggccgccgccggggtcgccgggatc
atcaaggccgtcatggcgatgcgcaacggcgtgctgcccaggaccctgcacgtggacgag
ccctcgcaccaggtcgagtggtcggcgggcaatgtgcggctgctcgcagaggagcagccc
tggcccgagctggatcgcccgcgccgtgcggccgtgtcctcgttcggcatcagcggcacc
aacgcccacgtgatcctcgaacaggtaccggtcctcgagccgtccgcacgtgagctcgaa
ccccgtgtagtgccgtggatcgtgtccggcaggacccccgaggcgttggccgcccaggtg
gcgcgaatgtctgatgtggacgctgacccgctcgacgtggcgtactccctcgcgactacc
cgtgccgcgctgcctcaccgtgcggcagttgccggtacggatcgtgcggagctgttgcgc
ggtctcgcagatgcgcagggcgctgctgccgagtctggcgccgtcgctttcctgttcacc
ggccagggcgcacagcgtgtcggcatgggccacgagctgtacgaggcgttcccggtgttc
gcgcaggcctgggacgccgtcgcggctcatctcggtgacgcgctgcgggtcgacgacgaa
cagttgctgaaccagaccggctacgcgcagcccgcgctgttcgcgcacgaggtcgccctg
taccggctgctggagtcctggggcgtcacaccggacttcgtcgctgggcactcggtcggt
gaactcgcggcggctcacgtcgccggagtgctctcactgaccgacgcctgcaccctggtg
agcgcgcgcggccgactgatgcaggccctgccgaccggcggcgcgatggtcgccgtgcag
gcgggcgagcacgagatccccagccgtgacggggtgggcatcgccgcggtgaacgggccg
tcctccgtggtgatctccggggacgaggccggtgtgctcgcgatccgcgccgagttcgag
gcgatgggccgcaggaccagtcggctgcgggtgtcgcatgccttccactccccgctgatg
gaaccgatgctcgcggagttcgcgcgggtcgccgaggggctgagcttcgccgcgccgagc
atcccgatgatgggacaggtcgactcgcccgagtactgggtgcgtcacgtgcgcgaggca
gtccggttccacgacgagatccgcgccctggaagcacatggcgtgacgcggttcgtggag
atcggcccggacggtgtgctgaccggcatggcccaggactgcgtcgagtccgaactcgcc
gcgtgcatcgccttgcagcgcaaggaccgcccccaggagcacgagctggtttccggcctg
gccaaggccttcagccacggcgtgcacgtggactgggcggcgttcttcgccgggaggggt
gcgcgccgggtcgatctgccgacctacgcgttccagcaccggcgctactggatcaacgcg
accgcggcgcacggtgacgtgtccgcggtgggtcaggtcgcgatcaaccacccgctgctg
ggtgctgctgtgtccacaccggacagtggcggcgtggtgctcaccggccgcctgtccgcg
cagacccagacttggctcgccgaccacgaggtgcgtggcagcatcctgttccccggtacc
ggtttcgtggaactggcagtccaggccggtgaccagatcggttgcggtgtggtcgaggaa
ctgacgatcggtgccccgctggtcgtgcccgcgcgcggcggcgtcgccgtgcaggtggtc
gtgaccgaagatcgccagttcagcgtgtactccggcggtgagggcacgtggaccagacac
gccaccggcttcctggccgaggcagacaccgcgcaggcgttcgacctcaccacctggcca
cccgctggcgccacacctgtcgagatcggtgacacctaccgggaactggccgaacagggc
tatggctacgggcctgtcttccagggcttgcgcgcagtgtggcggcgtggcgacgaggtg
ttcgccgaggtcgcgttgccggagggcagcgaggccgacaagtacgcgatgcacccggcg
ctgctcgacgcgaccctgcacgcgatgaacttcggcgagttcctcgaacccgccaaggac
gaggagatcacgctgcccttcgcgtggcgcggcgtgtccttgctggccgccggggccgcc
gcgctccgggtgcgcatggcatcggccggtacggacgcggtcaccatccaggtcgccgac
gcggccggtgcacccgtggcctccgtcgaatccctgctggtgcgggccatgtcggccaag
accacgtccattgccagcgacgcactgttccgagtggactggatcccggtggccgccggt
gcctgcaccagcaccgagctggacctccctggcgcggtggtcgtaccgatgatcaccgag
ccgaccggcgatctggcggccgacacgcacgcggcgacccagcgcgcgctgtcgctggtg
cagaactggttggcaggcgagtcggaacggcttgtcgtgcttaccaagggcgcgatgtcc
gcgcgcggagaggcggtcaccgaccttccggcggctgcggtgtggggcctgctgcgcgcg
gcccaggcggaggagccggaccgcatcactctgctggacgtcgacgagcacggactcccc
gagcaggcggtgctggccgccatcgagtccggcgaacctcaactggccgtccgcggtggc
gaggtgttcgcgccgcggctcacccgcaccgcgcttgccgagacgcccacggctgaactc
gacggcaccgtgctgatcacgggcggaaccggctcactcggcgcgctggtggcccgccac
ctcgttgcgcagtacggggttcggcacctcgtgctgaccagccgccgcggctcggacgcg
ccgggtgcggccgagctgtgcgccgaactgtccgagttgggcgccacggcaacggtcgtc
gcgtgcgatgtcgccgatcgtgccgcactgcaagctgttctggctgatgttcccgccgag
cacccgctcgtcggagtcgtgcacaccgcgggaaccctggcggacagcacgatcggcgcg
atcaccgccgagcagctcgactccgtgctgcggcccaaggtggacgccgcctggcacctg
cacgagctgaccaaggacctcgacctggccctgttcgtgctgttctcctcctcggccggt
gtcgtggacggtgcgggccagggcaactacgccgctgccaacacgttcctggacgcgctc
gcccagcaccgccgcgcgaacggcctgccgggtgtgtccctggcctggggcctgtggaac
caggtcggcggcatgtccgggcagctcaccgacgccgacctggcacgcctcgaacggtcc
ggcatcctgggcatcacacccgagcagggccttgacctgttcgacgccgcgctgagcagc
gacgagccgctgctggtgccgatccggctcaacaccaccgccttgcgatccaggtcggcg
ctgccctcggtgctgcgcggcctggtgcgcacgcgttcgcgccgcgtggtcgacgcctcg
ctcaccactggcggatccacgctggcacaacgacttgccgcgctcggcgagcccgagcgg
gtacagctgctgctggacctggtggggacgcacgtggccacggtgctgggccacgaacag
gccgccgccatcgatccgcgccgggcgttccgtgagctcggcttcgactcgctggcctcc
gtggaactgcgcaaccggctcaactccgccaccagcctgcgactgcccgccacgctggtc
ttcgactacccgacgcccgcggccctcgccgagcacatcggcgaccggctcctcggcgcc
gagtcaccggtcagcgccgccgtggcagtcaagtccgatgtggacgaagacccgatcgtc
atcgtgtcgatgagctgccgcttccccggcggggtcagctcacccgaacagctgtgggag
gtggtcgcctccggcaccgacgcggtgaccgcgatgcccaccaaccgcggctgggacgtg
gacggggtgtacgacccggagccaggcaagttcggcaagacctacaccaggcactccggg
ttcctgcacgaggccaccgatttcgacgccgagttcttcggcatctccccgcgcgaggcg
ttggccatggacccgcagcagcggctgctgctggagacctcctgggaggtgttcgagcgc
gcgggcatcgaccccagttcgttgcggggcagccggaccggcgtgttcgcgggcgtgttg
cagaccgactacgccagccgtctgacccaggtgcccgaggacgtcgagggctacctcacc
aacggcaacatgggcagcatcgcctccgggcgcatcgcctacgtgctcggcctggaaggt
cccgcgctcacgatcgacaccgcatgctccgcctcactggtggccatgcacatggccgcg
cagtccctgcggcagggtgagtgctcgctcgccctgaccggcggcgtcaccgtgatgtcc
acgcccgacctgctggtggacttcagccgtcagcgcgggctttccccggacggccgctgc
aaggccttcgcggaggccgccgacggcacgggcttcgccgagggcgtgggcatgctgctg
ctggagcggctgtccgacgcccgccgcaacgggcacccggtgctggcggtgatcaagggc
tcggcgatcaaccaggacggcgcgtccaacgggctcacggccccgaacggtccttcccag
caacgagtgctcagccaggccctggccaacgccgggctgtccgcggccgaggtcgacgtg
gtcgaggcacacggcacgggcacgaccctgggcgatcccattgaggcacaggcgttgttg
gccacctacggccaggaccgcacccgcccgttgtggctgggctcggtcaagtccaacatc
ggtcacacccagggcgcggccggtgccgcaggtgtgatcaagatggtgatggccatgcgg
cacgcgaccctgccgaagaccctgcacgtggacacgccttccactaaggtcgactggtcg
gcgggcgcgatcgaactgctcaccgaggcgcggccctgggaggtcaacggtcacccgcgt
cgtgcgggcgtgtcctccttcggcatcagtggcaccaacgcgcacctgatcatcgagcag
gcgccggacccggtggccaccgaagtgcagtccactgtgcacagttctgttccgctcgtg
ctgtccggcaggactgagaccgcactgcgagcacaggccgcccgcctggcggacttcctc
cgtgccgagcccaccgtcaacctggccgatgtctgcttctcgctgggcaccacgcgtgcc
gcgctggagcaccgcgccgtggtcgttggtggggaccacgagtcggtgctcgccgggttg
gccgcactggaaggctgggagtcctccactgatctcgtgcagggcaaggcctccggtggc
tcccggctggtcttcgtgttcccgggtcagggctcgcagtgggtcggcatggcggccgaa
ctgctggagcagtcaccggtgttcgccgagcgcctcgccgagtgctccgccgcgctctcg
tcctttgtggactggaatctgctcgacgtgatccgcggcgccgagggtacgccacccttc
gaacgggtcgacgtggtgcaacccgcactgtgggcggtgatggtgtcgctcgccgctgtc
tggcagtcgctgggcgtgcgaccggccgcggtgatcggccactcccagggtgagatcgcg
gcggcctgcgttgccggtgcactgtccattgaggatgctgctcgggtggtcgccctgcgc
agcaaggccatcggcgaggcgctggccggtcgcggcggcatggtgtcggtcgcgctgccc
gccgaggaggtcgccggacgcctggacgagtggggcggtcagctctcgctcgcggccgtc
aacggagcgaactcggtcgtcgtctccggcacaccggaggcgctcgaccagctgatgagc
cagttcggtgccgagggcgtccgcgtcaagaagatcgccgtggactacgcctcgcactcg
gcccaggtcgagacgatccgcgaccggctgcgcaccgacctcggtgccatcacgccgcgt
accggccaggtcccgttctactccacggtgaccagccagtgggtcgacagcgtggccctg
gacgccgagtactggtacgagaaccttcgccgcaccgtccagttcgacgaggcggtgcgg
actctggccggtgagggcttcggtggcttcgtcgagtcctcgccgcacccggtgctgacc
atcggcatccaggagaccctggacgtgctcgggcgggacgcggtcgtcaccggcacgctc
cgccgcgaggagggcggcccgcaccgcctgtgcctgtccctggccgaactgcacgtgcgc
ggaatcgccgtcgactggtcggccctgctgcccaacgccaggcgggtcgacctgccgacg
tatgccttccagcgcaagcgctactggctggacagcggcacaactgtggccgatgccagc
ggattcggccaggtcgccgccgaacacccgctgctcggtgccgtcgtaccgctgcccgag
tccgacggggtcgtgctgaccggacggctgtcgctgcactcccacccgtggctggctgac
cacgccgtcaacggtgtggccgtcttccccggcaccggcttcgtcgagctggcgatccgc
gcgggcgaccaggtcggctgcggccgtgtcgaggaactgacccttgaggcgccactcgtg
ctgcccgagcagggcgccatcggggtgcaggtctcgctcagcgcgcccgatcccgagggg
cgacgtgcgctgaacgtgtactccagcgccgtggacgagtcgtggacccggcacgccacc
ggcttgctggcaccggccgtccaggtcgacgcgcacgacctgaccgtgtggccaccggaa
ggcgccagcctgatcaccgtggacgagccgtaccggcagctggccgagcgcggctacggg
tacggccccgctttccagggcctgcgcaccgtgtggcggcgcggcgccgaggtgttcgcc
gaggtcacgctgcccgccaccgccgaagcagcccagttcgggctgcaccccgcgctgctc
gacgccgcgctgcacgccgacaccttgttcgaggacgagacccgcaccgtgctgccgttc
gcctggaacggggtcacgctgcacgccgccggcgcctccgcgctgcgtgtgcgactgctg
cgcgacgagtccggcaacatcagtgtcgatgccgccgatctgaccggtgcccccgtggcc
accgtgtcctcgctggcggtccgcgtggtctccgacgcccaactcggttcggcccggacc
acgggcgccgactcgctgctgcgggtcgagtggacgccgatcaccgggtcggcgaccgaa
ccgaccgggacctgggcgaccgtcggtgagtcggtgcccgacctcgacgcggctgccggt
gccgatgtcgtggtgctacccgtccgcgccgactcctccgacgtgcccgcagcagcccac
gccgccaccaaccgcgtgctgacctccgtgcagaccgttctgtccgacgaacgattcgcc
accgccacgttgctggtcctaaccaacggggcggtgtgcgccactgaagacgaggacgtg
tcggatctggccagcgccgcggtgtggggtctgatccgcgccgcgcaggaggagaacccg
gaccgcttcgtgctggtcgacgccgagtcgccgacctcgcagcagctgtccgccgtgctg
gccagcggtgagccgcaggtggcgatccgcggtgatgcgctgctggcgcccaggttggcc
tgggcgcagggccgtgcgcctgccgacgactgggacgcgcagtccacggtgctgatcacc
ggggccaccggcacgctgggcaggcacttcgcccggcacctggtggagcgcggcgtgcgg
cacctgctgttggtgagccgcagcggaggccggttcgacgagctcaccgagctgggcgca
cacgtcaccgtcgcggcctgcgacgctgcggaccgcgaggccctgcaacgcgtgctcgcg
gccgtcccggccgagcacccgctcagcgcggtggtgcacacggcgggcgtcctggacgac
gccacgatcgcctcgctgacacccgagcaggtcgaggcggtgctgcggccgaaggtcgac
gccgcgtggaacctgcacgagctgaccaaggacctgacccgcttcgtgctgttctcctcg
gcggcaggcaccttcggcggtgctggccagggcaactacgccgcggccaacgtcttcctc
gacgcgctggccgcacaccgcagggcccaggggctcgccgcgacctcgctcgcgtggggg
ttctgggctgagcgcagcacgatgaccggccagctcaccgaggccgacgtgcagcgcatg
accagcgctggcgtccagccgctgtccaccgagcatggcctgaggctgttcgacctcgcg
ctgggtggggctgatcccgtgctgctgccgatccagctcgacaccaccgtgctgcgcgag
ggcgaggtgcccgcgatcctgcgcggactcgtccggccgcccgcgcgacgggccgtgcag
gtcatcgagcaggacaccgaactgtccctcgccgagcggctgaccgcgttgtcggcaccc
gagcgggaacggctcgtgctggacctggtgcgcggtcacatcgcgaccgtgctccggcac
gagggtgccgccgcgatcgagccgaaccgcgagttcgccgaactcggcttcgactcgctg
tccgcgctggaactgcgcaaccggctcagcggcatggccggggtccggctgcccgccacc
ctggtgttcgactacccgtcaccggccgccgtggctcgccacctgctcgccgagctcgtc
gacgaggaggaactggccatgtcctcgctcgacgccgacctcgccaggctggaggccgcg
ctggccggggtgacccccgacgacgcccagcacgacaggatcgccgcccggctgcgtgcg
ctcaccacccggtgggtcgagtcgttcggacgggccgagcagccggtcgacgacggcgcc
cagctcaggtcggcgaccgcggacgagctgttcagcatcctcgacggcgagttggaggcg
cagaactag

DBGET integrated database retrieval system