KEGG   Kutzneria albida: KALB_1994Help
Entry
KALB_1994         CDS       T03039                                 

Definition
(GenBank) Pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
kal  Kutzneria albida
Pathway
kal00010  Glycolysis / Gluconeogenesis
kal00030  Pentose phosphate pathway
kal00051  Fructose and mannose metabolism
kal00052  Galactose metabolism
kal00680  Methane metabolism
kal01100  Metabolic pathways
kal01110  Biosynthesis of secondary metabolites
kal01120  Microbial metabolism in diverse environments
kal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KALB_1994
   00030 Pentose phosphate pathway
    KALB_1994
   00051 Fructose and mannose metabolism
    KALB_1994
   00052 Galactose metabolism
    KALB_1994
  09102 Energy metabolism
   00680 Methane metabolism
    KALB_1994
Enzymes [BR:kal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KALB_1994
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     KALB_1994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AHH95364
UniProt: W5WAX0
LinkDB All DBs
Position
2157371..2158396
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGIEVHGWEVVGFRNGWKGPMEGLTKQLGLDEVEEI
LARGGTILGSSRTNPYKVDGGVGQIKKVLAEHGVDALVAIGGEDTLGVAKRLTDDGVPVV
GVPKTIDNDLGNTDYTFGFDTAVHIATEAIDRLRTTAESHHRALVVEVMGRHAGWIALHS
GLAGGANVILVPERQFSVDKVVEWTQRRFERQYAPIIVVAEGAMPEGGAEVLTSGEKDAF
GHVRLGGVGTWLAEEIAQRTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLHAVDAVAEG
DFGVMVALHGTDIVRVKLSEATAELKTVPLHRYEEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggtgtgctcaccggcggtggcgactgtcccggcctgaacgcggtgatccgc
gctgtggtccgcaagggcatcgaggtgcacggctgggaggtcgtgggcttccgcaacggc
tggaagggtccgatggagggcctgaccaagcagctgggcctggacgaggtcgaggagatc
ctggccaggggcggcacgatcctcgggtcctcgcggaccaacccgtacaaggtcgacggc
ggggtcggccagatcaagaaggtgctggccgagcacggggtcgacgcgctggtggccatc
ggcggcgaggacaccctcggcgtggccaagcggctgaccgacgacggcgtgccggtggtc
ggcgtgcccaagacgatcgacaacgacctgggcaacaccgactacaccttcggcttcgac
accgcggtgcacatcgccaccgaggcgatcgaccggctgcgcaccaccgccgagtcgcac
caccgcgcgctggtcgtggaggtcatgggccgccacgcgggctggatcgccctgcactcg
ggcctggccggcggcgccaacgtcatcctggtgcccgagcgccagttcagcgtggacaag
gtcgtggagtggacccagcgccgcttcgagcgccagtacgccccgatcatcgtggtggcc
gagggcgccatgcccgagggcggggccgaggtgctgacctccggtgagaaggacgccttc
gggcacgtccggctcggcggcgtgggcacctggctggccgaggagatcgcgcagcgcacc
ggcaaggagtcccgcgcggtcgtgctcggccacgtgcagcgcggcggcacccccaccgcc
tacgaccgggtgctggccacccgcttcggcctgcacgcggtggacgccgtggccgagggc
gacttcggcgtgatggtggccctgcacggcaccgatatcgtccgggtgaagctgtcggag
gccaccgccgagctgaagaccgtgccgctgcaccggtacgaagaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system