KEGG   Kutzneria albida: KALB_2165Help
Entry
KALB_2165         CDS       T03039                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kal  Kutzneria albida
Pathway
kal00250  Alanine, aspartate and glutamate metabolism
kal00410  beta-Alanine metabolism
kal00640  Propanoate metabolism
kal00650  Butanoate metabolism
kal01100  Metabolic pathways
kal01120  Microbial metabolism in diverse environments
Module
kal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KALB_2165
   00650 Butanoate metabolism
    KALB_2165
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KALB_2165
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KALB_2165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kal01007]
    KALB_2165
Enzymes [BR:kal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KALB_2165
Amino acid related enzymes [BR:kal01007]
 Aminotransferase (transaminase)
  Class III
   KALB_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHH95534
UniProt: W5WBD9
LinkDB All DBs
Position
2350852..2352156
Genome map
AA seq 434 aa AA seqDB search
MVHEELLARHRAVLPSWLALYYEQPIEIVRGEGRRVTDGEGRTYLDLFAGILTNAIGYDI
AEIREAVRAQLDSGVVHTSTLYLIRQQVELAEKIARLSGIPDAKVFFTNSGTEANETALM
LATQHRRSNQVLALRNSYHGRGFGTIAITGNRGWSASSLSPVNVSYVHGGNRNRGPFKDF
SDAEYIRACVADLREVLATATSGDVACLIAEPIQGVGGFTTPPDGLLGAFKEVLDEFGIL
LISDEVQTGWGRTGEHFWGIQAHGVVPDMMTFAKGLGNGLAIGGLVARGDLMDCLTANSI
STFGGNPVSTAAANATLDYLLDHDLQANAFKVGNQLMDGLRRIAEEEPVIGDVRGKGLMI
GVELVEPGTDEPSSRAAARMMEHTRERGLLIGKGGQGGNVLRLAPPMTLTEAEAEEALGI
LADSIAATSAELAR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacgaggagctgctcgccaggcacagggccgtgctgccgagctggcttgccctc
tactacgagcagccgatcgagatcgtgcgcggcgagggccgccgggtcaccgacggcgag
ggccgcacctacctggacctgttcgcgggcatcctgaccaacgcgatcggctacgacatc
gccgagatccgcgaggcggtccgcgcccagctcgacagcggggtcgtgcacacctccacc
ctgtacctgatccgccagcaggtggagctggcggagaagatcgcgcgcctgtcgggcatc
ccggacgccaaggtgttcttcaccaactccgggaccgaggccaacgagacggcgctgatg
ctggccacccagcaccgccgcagcaaccaggtgctcgcgctgcgcaactcctaccacggc
aggggtttcggcacgatcgccatcaccggcaaccggggctggtcggcctcctcgctcagc
ccggtcaacgtcagctacgtgcacggcggcaaccgcaaccgcgggccgttcaaggacttc
agcgacgccgagtacatcagggcctgcgtcgcggacctgcgcgaggtgctggccaccgcc
acctccggggacgtggcctgcctgatcgccgagccgatccagggcgtcggcggcttcacc
accccgccggacggcctgctcggcgcgttcaaggaggtgctcgacgagttcggcatcctg
ctgatctccgacgaggtgcagaccggctggggccgtaccggggagcacttctggggcatc
caggcgcacggggtggtgccggacatgatgaccttcgccaagggactgggcaacgggctg
gccatcggcggcctggtcgcccgaggggacctgatggactgcctgaccgccaactccatc
tccaccttcggcggcaacccggtgtccaccgcggcggccaacgccaccctggactacctg
ctcgaccacgacctgcaggccaacgcgttcaaggtgggcaaccagctcatggacgggctg
cgccgcatcgccgaggaggagccggtgatcggggacgtgcgcggcaaggggctgatgatc
ggcgtggagctggtcgagcccggtacggacgagccgagttcgcgggcggcggcacggatg
atggagcacacccgcgagcgcgggctgctgatcggcaagggcgggcagggcggcaacgtg
ctgcgccttgccccgccgatgaccctgaccgaggcggaggccgaggaggcgctgggcatc
ctggccgactcaatcgccgcgacgagcgcggagctggcccgatga

DBGET integrated database retrieval system