KEGG   Kutzneria albida: KALB_2249
Entry
KALB_2249         CDS       T03039                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
kal  Kutzneria albida
Pathway
kal00997  Biosynthesis of various secondary metabolites - part 3
kal01100  Metabolic pathways
kal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    KALB_2249
Enzymes [BR:kal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     KALB_2249
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: AHH95618
UniProt: W5W353
LinkDB
Position
2437306..2438133
AA seq 275 aa
MRNVADTGKALRLRRLSRAGDGRYLFVPLDHSVSDGPVAGNEDWDELIRDLVLGGADAII
VHKGRIRAISPELLEDCALVVHLSAGTVHAADAHAKVLVGDVEDALRLGADAVSVHVNVG
SDTEARQLADLGAVASSCQEWNVPLIAMAYARGPRVRDSHDPEVLAHVVNIAADLGADLV
KTSMALPVDRMAEVTASCPIPVLAAGGPPAQADPDGSGLAEYARAALDVGCAGLAIGRRV
FSAPNPLSLVHRLAAVLHPDAVANHPSMTTGAGAA
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgcgcaacgtggctgacaccgggaaagcgcttcgcctgcggcgtctgtcgcgggcgggg
gacggcaggtacctgttcgtaccgctggaccacagcgtctccgacgggcccgtggcgggc
aacgaggactgggacgagctgatccgcgacctggtgctcggcggggccgacgcgataatc
gtccacaaaggacggatccgggcgatcagccccgaactgctggaggactgcgccctggtg
gtgcacctgagcgcgggcacggtgcacgccgccgacgcccacgccaaggtgctcgtcggc
gacgtggaggacgcgctgcggctgggcgccgacgcggtcagcgtgcacgtcaacgtcggc
tcggacaccgaggcgcggcaactggccgacctgggtgcggtggccagctcctgccaggag
tggaacgtcccgctgatcgcgatggcctacgcccgaggcccccgggtgcgtgactcgcac
gaccccgaggtactcgcccacgtggtgaacatcgccgccgatctcggcgcggacctggtg
aagacctccatggccctgccggtggaccgcatggccgaggtcaccgccagctgcccgatc
cccgtgctggccgcgggcggtccgcccgcgcaggccgacccggacggctcgggccttgcc
gagtacgcccgcgccgcgctggacgtgggctgcgcgggacttgccatcggccgcagggtg
ttctccgcgcccaacccgttgtcgctggtgcaccggctggccgccgtgctgcaccccgac
gccgtagccaaccacccctcgatgacgacaggtgcaggtgccgcgtga

DBGET integrated database retrieval system