KEGG   Kutzneria albida: KALB_3234Help
Entry
KALB_3234         CDS       T03039                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
kal  Kutzneria albida
Pathway
kal00500  Starch and sucrose metabolism
kal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KALB_3234
Enzymes [BR:kal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     KALB_3234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glucodextran_C Glyco_hydro_15 Big_6 PASTA CarboxypepD_reg
Motif
Other DBs
NCBI-ProteinID: AHH96601
UniProt: W5W7T2
LinkDB All DBs
Position
3569297..3572485
Genome map
AA seq 1062 aa AA seqDB search
MSRWGLTLLTAVALAATGAPALADTAPGGPGTNSYFDLGRKDCLGTARNNTSKIWYTVAN
GVLSDVYEPTIDNTNVGTLQYVVTDGTFTDVQTRDTTYTVAADKTGMACTVTATSRSHGY
QLVTTYVTDPARDSVVMRTRVDGPPNLRVYAQLDAHVNGNGGGGKDNGGADSGIVDGNAA
VVYDTGTVSQAANRDYAVPTYLAMQASSGKAPKVGYAGSQPGASAAANGHIVASQEVTPV
RGKEFTLTLGFGRTQQQAVDTGRASLAKPFEELRGDYEDGWRDYDSGLAPGTSTLDANVL
KASVDKTFPGAVAASLASPWGQAVNAGALVGGKPVYFGSYREVFARDAYEAFTGFLAAGD
RSTARAVARFLLTKQQLPTGEIPRNSLLNGKVAPDTGGDQLDETAYPILMAYLANLQDDR
PLWTDHVKPAADYLVSHGPFYGVERWEEQSGYSPSTIAAEIAGLTAAAAVAQRQGDGADA
RVYQAAADEFQRSVKSWTVTSSGPYAPRYFTRLTKNGDPNSAVRYNLGNGGPTVDQRSVV
DGGFQELVRLGELAPNDPDHLASLAVLDKQIAVRTATGTGYYRYGTSAAQGSADGYGECY
QPSQSSCKVVGQPWPTDNTGTGHLWPVLSGERAESKLLLGDQSGARELLDSMVNSASGVG
LVPEQAWESPDLAASPYGTDPATASIGFANGKAAGSAAPLTWAQAQRLRLRADLNANKVL
DRPELTTSRYVSNPAPGKAEVTISSPAAGSTVSGGTTSVTGHTVAGAAVTVQSAGTDVGS
HAATVSTTAGADGSFTVAVPVSFGATALSVGVSASANRTGFARVSVTGDLVGGTSVLDQA
DPAGDDHGPGTYQYPTAADFASGSFDLTRFQVISSGDTVYLRTTLANLVPTFGSTMGAQL
LDIYVGQPGKATSTAAPHPSRNYSVGPWSQRVELQGFAAPVWVDAAGNQVGTPTAAVASA
EGHTITVALPKAQFGDPAKGWTFAVVLTGQDGYSADLARGFTAAPSGYQFGVCAAGGTAP
VCRVDPGSVPKAVDVLTPTGTDQATELDPTRGSVLIKSVIVP
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgttggggtctgaccctgctcacggccgtggcgttggcggcaacgggggcaccg
gcgctggcggacacggcgcccgggggaccggggacgaactcgtacttcgacctggggcgc
aaggactgcctgggcacggcgcgcaacaacacctcgaagatctggtacacggtggcgaac
ggcgtgctgtcggacgtctacgagccgacgatcgacaacaccaatgtggggaccttgcag
tacgtggtgacggacgggacgttcaccgacgtgcagacgcgcgacacgacctacaccgtg
gcggcggacaagaccggcatggcctgcaccgtgacggccaccagccgcagtcacggctac
cagctggtgaccacgtatgtgaccgacccggcgcgggactcggtggtcatgcgcacgcgg
gtggacggcccgccgaacctgcgggtctacgcgcagctggacgcgcacgtgaacggcaac
ggtggcggcggcaaggacaacggcggcgcggacagcgggatcgtggacggcaacgccgcc
gtcgtgtacgacacgggcacggtgagccaggcggccaaccgggactacgcggtgccgacg
tacctggcgatgcaggcgagctcgggcaaggcaccgaaggtcggctacgcgggcagccag
cccggtgcgagcgcggcggccaatgggcacatcgtggcctcgcaggaggtcactccggtg
cgcggcaaggagttcacgctcacgctcgggttcgggcgcacgcagcagcaggcggtggac
accggccgggcctcgctggcgaagcccttcgaggagctgcgcggggactacgaggacggt
tggcgggactacgacagcggcctggcccctggaacgtccacactggacgcgaacgtgctg
aaggccagcgtggacaagaccttccccggtgcggtggccgcctcgctggccagcccgtgg
gggcaggcggtgaacgcgggcgcgctcgtgggcggcaagccggtgtacttcggctcgtac
cgggaggtgttcgcccgggacgcgtacgaggcgttcacgggcttcctggcggcgggggac
cggtccacggcgcgtgcggtggccaggttcctgctcaccaagcagcagctgccgaccggg
gagatcccgcgcaactccctgctgaacggcaaggtcgcgccggacaccggcggggaccag
ctggacgagacggcgtacccgatcctgatggcgtacttggcgaacctccaggacgaccgt
ccgttgtggactgaccacgtcaagcccgccgcggactacctggtgtcgcacgggcctttc
tacggagtggagcgctgggaggagcagtcgggctactcgccatcgaccatcgcggcggag
atcgcggggctgacggccgccgcggccgtcgcccagcggcagggcgacggcgcggacgca
cgggtgtaccaggcggcggccgacgagttccagcgctcggtgaagtcctggacggtgacc
agcagcgggccgtacgcgccgaggtacttcacccgcctgaccaagaacggcgacccgaac
tcggcggtccgctacaacctgggcaacggcgggccgaccgtggaccagcggtccgttgtg
gacggtggcttccaggaactggtgcggctgggcgagctcgcgccgaacgacccggaccac
ctggcctcccttgcggtgctggacaagcagatcgcggtgcggacggccaccggcaccggc
tactaccggtacgggacctcggcggcgcagggcagcgcggacggctacggcgagtgctac
cagcccagccagagctcctgcaaggtcgtgggccagccgtggccgaccgataacaccggt
acgggccacctgtggccggtgctgtccggggagcgggccgagtccaagctgctgctgggc
gaccagtccggtgccagggaactgctggacagcatggtgaactcggcgtccggggtcggg
ctcgtccccgagcaggcgtgggagtccccggacctggcggcctccccgtacggcacggac
ccggccacggcctcgatcgggttcgccaacggcaaggccgcgggatcggccgcaccgctg
acctgggcgcaggcacagcgcctgcggctgcgcgcggacctgaacgccaacaaggtgctg
gaccgtcccgagctgaccacgagccggtacgtcagcaatcccgctccgggcaaggccgag
gtcacgatcagctcaccggccgcgggcagcaccgtctccggcggcacgacctcggtcacc
ggccacacggttgccggggcggcggtcaccgtgcagtcggcgggcaccgacgtgggcagt
cacgcggccacggtcagcacgacggccggtgcggacggctcgttcaccgtggcggtcccg
gtgtccttcggggccacggcgctgagtgtgggcgtctcggcctccgccaaccggaccggg
ttcgcgcgggtctcggtgaccggtgacctcgtcggcggcacctccgtcctggaccaggcc
gacccggccggggacgaccacggtccgggcacctaccagtacccgacggcggccgacttc
gcctcgggttccttcgacctgaccaggttccaggtgatcagctccggggacacggtgtac
ctgcggaccacgctggccaacctggtgcccaccttcgggtccacgatgggcgcgcagctg
ctggacatctacgtgggccagccgggcaaggcgacctccacggcggcgccgcacccctcg
cggaactactcggtggggccctggagccagcgcgtcgagttgcagggcttcgcggccccg
gtatgggtggacgcggcgggcaaccaggtgggcaccccgaccgcggccgtggcctcggcg
gaaggccacacgatcaccgtggccctgcccaaggcccagttcggcgaccccgccaagggc
tggaccttcgcggtggtgctcaccggccaggacggctacagcgccgaccttgcgcgcggc
ttcaccgcggcccccagcggctaccagttcggggtctgcgccgcgggcggtaccgcgccg
gtctgccgggtcgatccgggttcggtgcccaaggcggtggacgtgctcacgcccaccggc
accgatcaggccacggagctggacccgacccggggcagcgtgctgatcaagtcggtcatc
gtgccctga

DBGET integrated database retrieval system