KEGG   Kutzneria albida: KALB_3372Help
Entry
KALB_3372         CDS       T03039                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
kal  Kutzneria albida
Pathway
kal00071  Fatty acid degradation
kal00280  Valine, leucine and isoleucine degradation
kal00281  Geraniol degradation
kal00310  Lysine degradation
kal00360  Phenylalanine metabolism
kal00362  Benzoate degradation
kal00380  Tryptophan metabolism
kal00410  beta-Alanine metabolism
kal00627  Aminobenzoate degradation
kal00640  Propanoate metabolism
kal00650  Butanoate metabolism
kal00903  Limonene and pinene degradation
kal00930  Caprolactam degradation
kal01100  Metabolic pathways
kal01110  Biosynthesis of secondary metabolites
kal01120  Microbial metabolism in diverse environments
kal01130  Biosynthesis of antibiotics
kal01212  Fatty acid metabolism
Module
kal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KALB_3372
   00650 Butanoate metabolism
    KALB_3372
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KALB_3372
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KALB_3372
   00310 Lysine degradation
    KALB_3372
   00360 Phenylalanine metabolism
    KALB_3372
   00380 Tryptophan metabolism
    KALB_3372
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KALB_3372
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KALB_3372
   00281 Geraniol degradation
    KALB_3372
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KALB_3372
   00627 Aminobenzoate degradation
    KALB_3372
   00930 Caprolactam degradation
    KALB_3372
Enzymes [BR:kal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KALB_3372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 EccE
Motif
Other DBs
NCBI-ProteinID: AHH96739
UniProt: W5WF05
LinkDB All DBs
Position
complement(3735143..3735883)
Genome map
AA seq 246 aa AA seqDB search
MGISSSSKGSGIVTVTVDYPPVNAVPVRGWFDLAEAVHSAGQDPDTRVVVLRARGRGFCA
GVNIKEIQNGHGHEALIGANRGCAAAFGAVYDCAVPVIAAVHGFCLGGGVGLVGNADVVI
ATEDASFGLPEVDRGALGAATHLARLVPQHLMRVLYYTARRISAHELHHHGSVYQVVPAA
ELDTAASALAAEIAAKDPRVIRCAKEAINGIDPQPVHRSYRYEQGFTFELTLSGVADRAR
QAFLEG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggcatctccagcagcagcaaaggatccgggatcgtgacggtcaccgtggactacccg
ccggtcaacgcggtgcccgtgcgtggctggttcgacctcgccgaggccgtgcactccgcc
gggcaggacccggacacccgcgtggtcgtgctccgcgcgcgggggcgcgggttctgcgcg
ggcgtgaacatcaaggagatccagaacggccacgggcacgaggcgctgatcggcgcgaac
cggggctgcgcggcggctttcggcgcggtgtacgactgcgcggtgccggtgatcgccgcc
gtgcacgggttctgcctcggcggcggcgtgggcctggtcggcaacgccgacgtggtgatc
gccaccgaggacgcgtcgttcggactgcccgaagtggacagaggggcgctgggcgcggcc
acacacctggccagactggtgccacagcacctgatgcgcgtcctgtactacacggcgcgg
cggatcagcgcgcacgaactgcaccaccacgggtcggtctaccaggtggtgcccgcggcg
gagttggacacggcggcctcggcgctggcggcggagatcgcggccaaggacccgagggtg
atccgctgcgccaaggaggcgatcaacggcatcgacccgcagccggtgcaccgcagttac
cgctacgagcagggattcaccttcgagctcaccctgtccggggtggccgatcgggccagg
caggcgttcctggagggctga

DBGET integrated database retrieval system