KEGG   Kutzneria albida: KALB_3552Help
Entry
KALB_3552         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
Organism
kal  Kutzneria albida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BTAD TPR_12 NB-ARC Trans_reg_C TPR_1 TPR_2 AAA_16 AAA_22 TPR_10 NACHT ANAPC5 AAA_18 DUF2520
Motif
Other DBs
NCBI-ProteinID: AHH96916
UniProt: W5W8Q0
LinkDB All DBs
Position
3928240..3931218
Genome map
AA seq 992 aa AA seqDB search
MEFAILGSLRVSAGDRVVPLAAAKHRVLLAALLLRANHVVPVAELAERLWGSEPPASAKA
TLQGYVLRLRRGLTAQGGADPIETRPPGYLIRVAPGELDLDVFRTLVAESERAATAGDLD
TAAGRLRQAGALWRGPALSDVPSDSLHATAGPWLAELRRSAVERRVDLDLRRGEHTQLVG
ELTELVADNPLHERFRAQLMLALHRCGRSADALEVYRDARATFVEELGIEPGEPLRELER
AVLAGDPGLDWRCDADPPKSAPPRALPPDLPDLVGRDVLVHDMLARLSAPPRQPGSPVVQ
VIAGMAGVGKTALAVHLGHRLRDRFPDGQLHVTLQDGAGAVPPAEALGRLLRLLGVLGNH
LPDSVEARSLLLRDRLAGKRALLLLDDAVDEAQVRPLLPGDSSCTVLVTSRNRLTGLSGA
HTVDLRVLDEQQAVRLLGTVVGGDRVRTEPRASAELVRQCGGLPLALRIAGARLAARTSR
PVDWLVRQLEDERRRLDGLSAGDLRVRASLATSYRALDPEQQRAFRLLGLLNTGEYTPQL
AAAALDREPHRAEELVEQLVDAQLVDFTGVADRYRSHGLVRLYAREQAVATDSEADRRGV
VERTLTTWLAATTQAEARMPNAGWWPCPPPRPVRARVEPVGDALAWFDAERAELGVAVDQ
AVSEGHAELGWRIAAASGCYLELRGYWDEWRQGHERALAGAVAAGDEPGAALMRYGLGRL
WFAKDHYELALDMLCRALDSWARLDDRSSQAHTQSLLGDVHHHTGRLDLAGHHFRLAHRG
YEAVGDDRGLANSQLCLGLLHRDLGEPGQALGCLREALDGFRALGDQYGEAQVLRFLGAS
HGKWGQPDIARDYFTQAAALYREFGDRLGELRSVRHLGHVLALHGDGGHARRVLLSCHAS
FAEIGDSFGVATACWSLGELALREADPRAADRWLREALELVEEAGLVHWQARMLRLLAET
HRRAGQSVLAEQLTSRADALAMTQRKTAAVGR
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgcgatcctggggtcgctgcgggtcagcgcgggcgaccgcgtagtgccgctg
gcggccgccaagcaccgggtgctgctggccgcgctgctgctgcgcgccaaccacgtggtg
ccagtcgccgaactggccgagcggctgtgggggagcgagccgccggccagcgccaaggca
acgttgcagggctacgtgctgcggctgcggcgcggcctcaccgcccagggcggcgccgac
ccgatcgagacccggccgccgggctacctgatcagggtcgcacccggcgaactggacctg
gacgtgttccgcacgctggtggccgagtccgagcgggccgcgaccgccggtgacctggac
acggccgccggccggctcagacaggcgggtgcgctgtggcgcgggcccgcgctgtccgac
gtgccctccgactcgctgcacgccacggccggtccctggctcgcggagctgcggcgcagc
gccgtggagcgccgcgtggacctggacctgcggcgcggcgagcacacccagttggtcggc
gagctgaccgagttggtcgccgacaacccgttgcacgagcggttccgagcccagctcatg
ctcgcgctgcaccggtgcgggcgcagcgccgacgcgctggaggtctaccgggacgcgcgg
gccacgttcgtcgaggaactgggcatcgagccgggcgagccgctgcgggagctggagcgc
gccgtgctggctggtgatccgggcctggactggcgctgcgatgcggatccgcccaagtcc
gccccgccccgcgcgctgccccctgacctgcccgacctggtcggccgcgacgttctcgta
cacgacatgctcgcccggctcagcgccccgccccggcagccgggcagtcccgtggtgcag
gtcatcgcgggcatggccggggtgggcaagacggcgctggccgtgcacctcgggcaccgg
ctgcgcgaccggttcccggacggccagctgcacgtgaccctgcaggacggcgcgggcgcg
gtgccgccagccgaggcgctgggcaggctgctgcggctgctcggcgtgctgggcaaccac
ctgcccgacagcgtggaggcccgctccctgctgctgcgcgaccgcctggcgggcaagcgg
gcactgctactgctcgacgacgccgtggacgaggcgcaggtccgcccgctgctgcccggt
gacagctcgtgcaccgtgctggtcaccagccgcaaccggctcactgggctgtccggggcg
cacaccgtggacctgcgcgtgctggacgagcagcaggcggtccgcctgctgggcaccgtg
gtcggcggggaccgggtccgcaccgaaccgcgggccagcgccgaactggtgcgtcagtgc
ggcggcctgccgctggccctgcgcatcgcgggcgcccggctggccgcccgcaccagcagg
ccggtggactggctggtgcgccaactggaggacgagcggcggcgcctggacgggctgtcc
gccggcgacctgcgggtgcgggccagcctggccaccagctaccgcgcgctggaccccgag
cagcagcgggcgttccggctgctggggctgctcaacaccggcgagtacaccccgcagctg
gcagccgccgcgctggaccgcgagccgcaccgtgccgaggaactggtcgagcagctggtg
gacgcccagctggtggacttcaccggggtggccgaccggtaccgcagccacgggctggtc
cgcctgtacgcccgcgaacaggcggtggccaccgacagcgaggcggaccgccgcggggtc
gtggagcgtacgctgaccacctggctggccgcgaccacgcaggccgaggcccgcatgccg
aacgcgggctggtggccctgcccgccaccccgcccggtccgggcccgtgtcgaaccggtg
ggtgacgccctggcctggttcgacgccgagcgggcggagctgggcgtcgccgtggaccag
gcggtgtcggagggacacgcggaactcggctggcgcatcgccgccgcctcgggctgctac
ctggagctgcgcgggtactgggacgagtggcggcagggccacgagcgcgcgctggcgggc
gcggtcgccgccggggacgagcccggtgcggcgctcatgcggtacgggctgggcaggctg
tggttcgccaaggaccactacgagctggccctggacatgctgtgccgcgccctggacagc
tgggcgcgcctggacgaccgctcgtcgcaggcgcacacgcagtccctgctcggcgacgtg
caccaccacaccgggcggctggacctggccgggcaccacttcaggctggcccaccgcggc
tacgaggccgtcggtgacgaccgcgggctggcaaactcccagctgtgcctcggcctgctg
caccgcgacctgggcgaacccgggcaggcactgggttgcctgcgggaggcgctggacggc
ttccgcgccctgggcgaccagtacggggaggcccaggtgctgcgcttcctcggcgccagc
cacggcaagtgggggcagcccgacatcgcccgcgactacttcacccaggccgccgccctg
taccgcgagttcggcgaccggttgggggagttgcgcagcgtgcggcacctcgggcacgtg
ctcgcgctgcacggggacggcgggcacgcccgcagggtgctgctgtcctgccacgcctcc
ttcgcggagatcggcgactccttcggggtggccacggcctgctggagcctgggcgaactg
gccctgcgcgaggcggacccgcgggccgccgaccgctggctgcgcgaggcgttggagctg
gtggaggaggccggactggtgcactggcaggccaggatgctgcgcctgctggccgagacg
caccggcgcgcgggccagtcggtgctggccgagcagctcacgtctcgggccgatgcgctg
gccatgacacagcggaaaacagcggcggtcggtcggtga

DBGET integrated database retrieval system