KEGG   Kutzneria albida: KALB_4714
Entry
KALB_4714         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
kal  Kutzneria albida
Pathway
kal00523  Polyketide sugar unit biosynthesis
kal01100  Metabolic pathways
kal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    KALB_4714
Enzymes [BR:kal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     KALB_4714
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase DUF1707 SHMT
Other DBs
NCBI-ProteinID: AHH98076
UniProt: W5WC08
LinkDB
Position
complement(5254159..5255370)
AA seq 403 aa
MKRGVDDLALFGGHAEFDQTLLVGRPSTGDRTKLYERLDRALDNGRLTGGGMLVREFEDR
IAHMAGTRHCIAVCNATAALEVIIRAQNLHGEIIIPSMTFIATAHAVRYMGATPVFADID
PVTGTIDPDHVETLITPHTTAIIGVHLWGQPCDVDRLADIAHRHNLTLIYDAAHGIGCSH
GPTPIGGFGHAEVFSFNATKVVNSFEGGAIVTNDDDFALRVRQAHNFGFIAPGLIGGLGT
NAKMSEASGAMGLTSLDVFDEVVAHNKAGYDLYRDLLAGLPGLTVHAYDPRHRNNFQYVV
VKVDQDHAGLHRDVLLDVLRAENVYALMYFSPACHQLEPYRSEHPVTLPHTERLAEQVIA
LPTGPATTSSDIHRVCEIVRFAIEHSAEIVEAFGRIDLNSCKN
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaagcgcggagttgacgacctcgccctgttcggcggccacgcggagttcgaccagacc
ctgctggtcggccgccccagcaccggcgaccgcacaaaactctacgaacgcctcgaccgc
gcactggacaacggccgcctcaccggcggcggcatgctcgtccgcgagttcgaggaccgc
atcgcccacatggccggaacccgccactgcatcgcggtctgcaacgccaccgccgccctg
gaagtcatcatccgcgcccagaacctgcacggcgagatcatcatcccctcgatgaccttc
atcgccaccgcccacgccgtgcgctacatgggcgccacccccgtcttcgccgacatcgac
ccggtcaccggcaccatcgaccccgaccacgtcgaaaccctcatcaccccccacaccacc
gccatcatcggcgtccacctctggggccaaccctgcgacgtcgaccgcctcgccgacatc
gcccaccgccacaacctcaccctcatctacgacgccgcccacggcatcggctgcagccac
ggccccacccccatcggcggcttcggccacgccgaggtcttcagcttcaacgccaccaaa
gtcgtcaactccttcgagggcggcgccatcgtcaccaatgacgacgacttcgccctgcgc
gtacgccaggcccacaacttcggcttcatcgcccccggcctgatcggcggcctgggcacc
aacgccaagatgagcgaggcctccggcgccatgggcctgacctccctggacgtcttcgac
gaggtcgtcgcccacaacaaggccggctacgacctctaccgcgacctgctcgccggactc
cccggcctgaccgtgcacgcctacgacccacgccaccgcaacaacttccagtacgtcgtg
gtcaaggtcgaccaggaccacgccggcctgcaccgcgacgtcctgctcgacgtgctgcgc
gcggagaacgtctacgccctgatgtacttctcacccgcctgccaccaactcgagccctac
cgcagcgaacaccccgtcaccctcccgcacaccgaacgcctggccgaacaggtcatcgcc
ctgcccaccggaccggccaccacctcctccgacatccaccgggtctgcgagatcgtccgc
ttcgccatcgaacacagcgccgagatcgtcgaggctttcggaagaattgatctgaattcc
tgcaagaactga

DBGET integrated database retrieval system