KEGG   Kutzneria albida: KALB_4720Help
Entry
KALB_4720         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
kal  Kutzneria albida
Pathway
kal00250  Alanine, aspartate and glutamate metabolism
kal00410  beta-Alanine metabolism
kal00430  Taurine and hypotaurine metabolism
kal00650  Butanoate metabolism
kal01100  Metabolic pathways
kal01110  Biosynthesis of secondary metabolites
kal01120  Microbial metabolism in diverse environments
kal02024  Quorum sensing
Module
kal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KALB_4720
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KALB_4720
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KALB_4720
   00430 Taurine and hypotaurine metabolism
    KALB_4720
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KALB_4720
Enzymes [BR:kal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KALB_4720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AHH98082
UniProt: W5WAX6
LinkDB All DBs
Position
complement(5259479..5260882)
Genome map
AA seq 467 aa AA seqDB search
MPLSHPSQHSDSGRPELSINPIFTREPLSVPRNRLPDAELDPETAYQVVHDELMLDGNSR
LNLATFVTTWMEPQAARLMAECADKNMIDKDEYPRTAELEMRCVRMLAQLWHAPPAETAT
GCSTTGSSEACMLAGLALKRRWQHARRAQGKPTDRPNLVMGVNVQVCWDKFANYWDVEPR
LVPMEGERFTLSAEEAVKLCDENTIGVVAILGSTFDGSYEPVAEICAALDELHERTGLDV
PVHVDGASGAMVAPFCDPDLAWDFRLPRVASINTSGHKYGLVYPGVGWVVWRDAEALPED
LVFRVNYLGGDMPTFALNFSRPGAQVVAQYYNFLRLGFDGYRRVQQSCREVATSLAARLA
KLGAFRLITDGSQLPVVAFTLAEEVTGYSVFDVSAELRQHGWLVPAYTFPPDREDLSVLR
LVVRNGFSHDLADLFLDDLERVVGRLQQRSGPQRGPEAAGFAHGAGR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctcgcacccctcgcagcacagcgactcgggccggcccgagctgtccatcaat
ccgatcttcaccagggaaccgctgtccgtgccgcgcaaccggctgcccgacgcggagctg
gaccccgagaccgcctaccaggtggtgcacgacgaactgatgctggacggcaactcccgg
ctcaacctggccaccttcgtgaccacctggatggaaccccaggcggcgcggctgatggcc
gagtgcgcggacaagaacatgatcgacaaggacgagtacccgcgcaccgccgagctggag
atgcgctgcgtgcggatgctcgcccagctctggcacgccccgcccgccgagaccgcgacc
ggctgctccaccaccggctccagcgaggcctgcatgctcgccgggctggcgctcaaacgc
cgctggcagcacgcccgccgcgcccagggcaagccgacggaccgccccaacctggtgatg
ggcgtgaacgtgcaggtgtgctgggacaagttcgccaactactgggacgtggagccccgg
ctggtgcccatggagggggagcggttcaccctgtcggcggaggaagccgtcaagctgtgc
gacgagaacaccattggcgtggtggcgatcctgggctcgaccttcgacggcagctacgag
ccggtcgcggagatctgcgccgcgctggacgagttgcacgagcgcaccgggctggacgtg
ccggtgcacgtggacggcgcctccggggcgatggtggcgccgttctgcgatcccgacctg
gcctgggacttccgcctgccccgggtggcctcgatcaacacctccgggcacaagtacggg
ctggtgtacccgggcgtgggctgggtggtgtggcgcgacgccgaggcgctgccggaggac
ctggtgttccgggtgaactacctcggcggggacatgcccaccttcgcgctgaacttctcc
cggccgggggcgcaggtcgtcgcccagtactacaacttcctgcgcctgggcttcgacggc
taccggcgggtgcagcagagctgccgcgaggtggccacctcgctggccgcgcgcctggcc
aagctcggcgccttccggctgatcaccgacggcagccagctgccggtggtcgccttcacc
ctcgccgaggaggtcaccggctactcggtgttcgacgtgtccgccgagctgcgccagcac
ggttggctggtgcccgcctacaccttcccgcccgatcgtgaggacctgtcggtgctgcgc
ctggtggtgcgcaacggtttcagccacgacctggccgacctgttcctggacgacctggaa
cgggtggttggccggttgcagcagcggagcggcccacagcggggccccgaggccgccggt
ttcgcgcacggggccgggcgctag

DBGET integrated database retrieval system