KEGG   Kutzneria albida: KALB_5888Help
Entry
KALB_5888         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
kal  Kutzneria albida
Pathway
kal00061  Fatty acid biosynthesis
kal00780  Biotin metabolism
kal01100  Metabolic pathways
kal01212  Fatty acid metabolism
Module
kal_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:kal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KALB_5888
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KALB_5888
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kal01004]
    KALB_5888
Enzymes [BR:kal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     KALB_5888
Lipid biosynthesis proteins [BR:kal01004]
 Fatty acid synthase
  Component type
   KALB_5888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AHH99249
UniProt: W5WM58
LinkDB All DBs
Position
complement(6546536..6547012)
Genome map
AA seq 158 aa AA seqDB search
MTGVDRIKALIPHRYPILLVDRVSEVDPGRTLVAHKAVTVAEPCYAHLPEDAPAQAYAYP
VSLLLESWAQSAVILACWLKPNPDVLAGKVELAAGLRGAELLAPVYPGVVLEHRVQVLRE
VDEAAVVAGSTLVDGETVLRVAQFTVALRDSSVLGVGV
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggtggaccggatcaaggcgctcatcccgcaccggtacccgatcctgctggtg
gaccgggtgtccgaagtggacccagggcggaccttggtggcgcacaaggcggtcacggtg
gccgagccgtgctacgcgcacctgcccgaggacgcgcccgcacaggcctacgcctacccg
gtgagcctgctgctggagtcctgggcgcagtcggccgtgatcctcgcctgctggctcaag
cccaacccggacgtgttggcgggcaaggtggagctggccgcgggcctgcgcggtgccgag
ctgctggccccggtgtacccgggtgtggtgctggagcaccgggtgcaggtgctgcgcgag
gtggacgaggcggccgtggtcgcgggcagcaccctggtggacggcgagaccgtgctgcgg
gtcgcccagttcacggtggcgctgcgcgactcctcggtgctgggggtgggggtgtga

DBGET integrated database retrieval system