KEGG   Kutzneria albida: KALB_5967Help
Entry
KALB_5967         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K04079  molecular chaperone HtpG
Organism
kal  Kutzneria albida
Brite
KEGG Orthology (KO) [BR:kal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kal01009]
    KALB_5967
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:kal03110]
    KALB_5967
   04131 Membrane trafficking [BR:kal04131]
    KALB_5967
   03051 Proteasome [BR:kal03051]
    KALB_5967
   03029 Mitochondrial biogenesis [BR:kal03029]
    KALB_5967
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kal04147]
    KALB_5967
Protein phosphatases and associated proteins [BR:kal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     KALB_5967
Chaperones and folding catalysts [BR:kal03110]
 Heat shock proteins
  HSP90
   KALB_5967
Membrane trafficking [BR:kal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    KALB_5967
Proteasome [BR:kal03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    KALB_5967
Mitochondrial biogenesis [BR:kal03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    KALB_5967
Exosome [BR:kal04147]
 Exosomal proteins
  Proteins found in most exosomes
   KALB_5967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c
Motif
Other DBs
NCBI-ProteinID: AHH99327
UniProt: W5WEQ0
LinkDB All DBs
Position
6648132..6650006
Genome map
AA seq 624 aa AA seqDB search
MTAPIETLEFQSEARQLLQLMIHSIYSNKDTFLRELVSNASDALDKLRLEAFRDKELQAD
TSDLHVAIEIDSEQRTLTVRDNGIGMSRDEVISLIGTIAKSGTAEFLRKLKESQDAAASQ
ELIGQFGVGFYASFMVADKVTLVTRKAGSDEGVRWESEGAGTYTIEPVADAPQGTAVTLH
LKPVDAEDQLFDYTSAAKVREIVKRYSDFLTWPIRMAAEPTEEGAEPTVETVNSMKALWA
RASSEVTEQEYTEFYKHISHDWNDPLETVRFQAEGTFEYQALLFIPSRAPMDLFMRERKR
GVQLYVKRVFIMDDCEALMPEYLRFVKGVVDAADLSLNVSREILQQDRQIQLIRKRLVKR
VLSTVKSLDAEKYGTFWKEFGRAVKEGLLDDFDNREAILEICSFESTHDADKPTRLAQYV
ERMKEGQEHIYYLTGESRTAIENSPHLEAFQAKGFEVLVLTDPIDEMWVDAVPGFEGKQF
QSIAKGQVDLDENQDEEQKAEFAGLLTWMGSALEEHVKEVRLSSRLTTSPACIVGDSHDM
TPTLEKMYRAMGQQLPQIKRILELNPGHPLVAGLRAAHAERPEDERLPETAELIYGMALL
AEGGELGDPSRFVKLLANRLEQSL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgccgatcgaaaccctggagttccagtccgaggcccgtcagctgttgcagctg
atgatccactcgatctactcgaacaaggacaccttcctgcgcgagctggtgtccaacgcc
tcggacgcgctggacaagttgcggctggaggcgttccgcgacaaggagttgcaggccgac
acctcggacctgcacgtggcgatcgagatcgacagcgagcagcgcacactgacggtgcgg
gacaacggcatcggcatgagccgggacgaggtcatcagcctgatcggcacgatcgccaag
tcgggcaccgcggagttcctgcgcaagctcaaggagtcgcaggacgcggcggcctcgcag
gagctgatcggccagttcggcgtgggcttctacgcgagcttcatggtggccgacaaggtg
acgctggtgacccgcaaggcgggttcggacgagggcgtgcgctgggagtcggagggcgcg
ggcacctacacgatcgagccggtggcggacgccccgcagggcaccgcggtcaccctgcac
ctcaagccggtcgacgccgaggaccagctgttcgactacacctcggcggcgaaggtccgc
gagatcgtcaagcgctactcggacttcctcacctggccgatccggatggcggcggagccc
accgaggagggcgccgagccgaccgtggagacggtcaactcgatgaaggcgctgtgggca
cgcgcctccagcgaggtcaccgagcaggagtacaccgagttctacaagcacatcagccac
gactggaacgacccgctggagacggtgcgtttccaggccgagggtacgttcgagtaccag
gcgctgctgttcatcccctcgcgggcgccgatggacctgttcatgcgcgagcgcaagcgc
ggggtgcagctctacgtcaagcgcgtgttcatcatggacgactgcgaagcgctgatgccg
gagtacctgcgcttcgtcaagggcgtggtggacgccgcggacctgtcgctgaacgtctcg
cgggagatcctccagcaggacaggcagatccagctgatccgcaagcgcctggtcaagagg
gtgctgtccacggtgaagtccctggacgcggagaagtacgggaccttctggaaggagttc
ggccgggcggtcaaggaaggcctgctcgacgacttcgacaaccgggaggcgatcctggag
atctgctccttcgagtccacccacgacgcggacaagcccaccaggctggcccagtacgtg
gagcggatgaaggagggccaggagcacatctactacctcaccggcgagtcgcgcaccgcc
atcgagaactccccgcacctggaagccttccaggccaagggtttcgaggtgctggtgctc
accgacccgatcgacgagatgtgggtggacgcggtccccggcttcgagggcaagcagttc
cagtccatcgccaagggccaggtggacctggacgagaaccaggacgaggagcagaaggcg
gagttcgccgggctgctgacctggatgggcagcgcactggaggagcacgtcaaggaggtg
cggctgtcctcgcggctgaccacctccccggcctgcatcgtcggcgacagccacgacatg
acgcccaccctggagaagatgtaccgggcgatgggtcagcagctgccgcagatcaagcgc
atcctggagctcaacccggggcacccgctggtggcgggcctgcgcgcggcgcacgccgag
cgccccgaggacgagcggctgcccgagacggccgagctgatctacggcatggccctgctc
gccgagggcggcgaactcggtgacccgtcgcgcttcgtcaagctcctggccaaccgcctg
gagcagtcgctgtga

DBGET integrated database retrieval system