KEGG   Kutzneria albida: KALB_727Help
Entry
KALB_727          CDS       T03039                                 

Definition
(GenBank) Beta-galactosidase bgaB
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kal  Kutzneria albida
Pathway
kal00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KALB_727
Enzymes [BR:kal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KALB_727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_35 DUF4434 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AHH94102
UniProt: W5VZV4
LinkDB All DBs
Position
756920..758956
Genome map
AA seq 678 aa AA seqDB search
MYLCATLASVTGWPKRVPGLCWGADYNPEQWPEQVWAQDVALMREAGVNLVSVGIFSWAL
LEVEEGRYEFGWLDRVLDLLHEGGIRVDLATATASPPPWLTHRYPEVLPVREDGVRFSHG
SRQEYCPNSPVYREKSVALAEKLALRYAEHPALAAWHVNNEYGCHVRRCYCQRCAEAFRE
WLKARYSKDLAALNEAWGTAFWSQHYSDWAQVQPPRVTPTYGNPGQLLDFDRFGSDTLLE
LFVAERDVLRAITPDVPVTTNFMAGWTFGALDYWSWAREVDFVSNDHYTRAEDEQRHVEL
ALSADLVRGLAGGKPWLLMEHSTSAVNWQPRNRAKQPGELARNSLSHVARGADGTLFFQW
RASRAGAERYHSAMLPHAGSDTRVFREVCELGAAYRRCAELVGSTVDAQAALVFDFQAGW
AAEQPAHPTQDFRYHEAVLGVYRALWQAGITVDVVPPSADLGRYPLVVVPALYLVSDENA
RSFDQYVAAGGHLLMTWFSGITDEHARVRLGGYPGAFADLLGVRVEEFYPLGAGERVRLS
NGATADTWTELLHPEGAEVVASHVDGPLPGVPAITRNEHGSGLAWYVATTLDPDSMLGLV
REVAERAGARPVVRAPAGVEVVRRTGEGPRGPISWLVVVNHTGAEVVLPVRGIELAAGSD
VPGCLAVPAGGTAVVREV
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
gtgtatctgtgcgccaccctggcgagcgtgaccgggtggccgaagcgtgtgcctggcctc
tgctggggtgcggactacaacccggagcagtggcctgagcaggtatgggcccaggacgtg
gccctgatgcgcgaagccggggtcaacctggtcagcgtgggcatcttctcctgggccctg
ctggaggtcgaggagggccgttacgagttcggctggctcgaccgcgtgctggacctgctg
cacgaaggcggcatccgggtcgacctggccaccgccaccgcctcaccgccgccctggctc
acccaccggtaccccgaggtgctgccggtgcgcgaggacggggtgcggttcagccacggc
tcacgccaggagtactgcccgaactccccggtctaccgcgagaagtccgttgccctggct
gagaagttggcgctgcgctacgccgaacacccggcgctggcggcctggcacgtcaacaac
gagtacggctgccacgtgcggcgctgctactgccagcgctgcgccgaggccttccgcgag
tggctgaaagcccgctacagcaaggacttggccgcactgaacgaggcatggggcaccgcc
ttctggagccagcactactcggactgggcccaggtccagccgccgagggtgacgccgacc
tacggcaaccccgggcagttgctggacttcgaccggttcggcagcgacaccctgctggag
ctgttcgtggccgagcgggacgtgctgcgcgcgatcacccccgacgtgccggtcaccacg
aacttcatggcgggctggaccttcggcgcgctggactactggtcctgggcgcgtgaggtc
gacttcgtgtccaacgaccactacacccgtgccgaggacgagcagcggcacgtggagctg
gcgctgtccgccgacctcgtgcgcggactggccggcggcaagccgtggctgctgatggag
cactccacctcggcggtcaactggcagccccgcaaccgcgccaagcaacccggtgagctg
gcccgcaactccctgtcccacgtggcgcgcggcgcggacggcacgctgttcttccagtgg
cgcgcctcgcgggccggtgccgagcgctaccactcggcgatgctgccgcacgcgggctcc
gacacccgcgtgttccgcgaggtgtgcgagctcggcgccgcctaccggcgctgcgcggaa
ctggtcgggtccactgtggacgcccaggccgcgctggtgttcgacttccaggccgggtgg
gccgccgagcagcccgcccaccccacccaggacttccgctaccacgaggcggtcctcggg
gtgtaccgggcgctgtggcaggccgggatcaccgtggacgtggtgccgccctccgccgac
ctgggccgctacccgctggtggtcgtgcccgcgctctacctggtcagcgatgagaacgca
cgatcgttcgatcagtacgtggccgcgggcgggcacctgctgatgacctggttctccggc
atcaccgacgagcacgcccgcgtccggctgggcggctaccccggtgccttcgccgacctg
ctcggtgtccgggtggaggagttctacccgctcggcgccggggagcgggtccggctcagc
aacggtgcgacggcagacacctggaccgagctgctgcaccccgagggcgccgaggtcgtg
gcgtcccatgtggacggcccgctgcccggggtgcccgcgatcacccgcaacgagcacggc
tcgggtctggcctggtacgtggcgaccacgctggaccccgactcgatgctcgggctggtg
cgcgaggtcgccgagcgcgccggtgcacgaccggtcgtgcgggcacctgccggggtggag
gtcgtgcgcaggaccggcgaaggtccgcgggggccgatatcgtggctggtggtggtcaac
cacaccggggcggaggtcgtcctgccggtccggggtatcgaactggccgcgggcagcgat
gtgcccggttgtctggcggtgcccgctggtgggaccgccgtggtccgggaggtgtga

DBGET integrated database retrieval system