KEGG   Kutzneria albida: KALB_7856Help
Entry
KALB_7856         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
kal  Kutzneria albida
Brite
KEGG Orthology (KO) [BR:kal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KALB_7856
Enzymes [BR:kal01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KALB_7856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AHI01214
UniProt: W5WJ45
LinkDB All DBs
Position
8866837..8867244
Genome map
AA seq 135 aa AA seqDB search
MRLLSRILGPRLEASAHCDLPCGVYDPAQARIEAESVKAIQEKYQANEDPEFRARAISIK
EQRSELVKHHLWVLWTDYFKPPHFEKYPQLHELFNKATKAAGAGGTKASMDPAKGQELLD
LIAEIDKIFWETKAA
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgctgtcgcgcatcctcgggccgcgtctggaggcgagcgcgcactgcgatctg
ccttgcggcgtctacgaccccgcgcaggcccgcatcgaggcggagtcggtcaaggcgatc
caggagaagtaccaggccaatgaggacccggagttccgggcgcgcgccatctccatcaag
gagcagcgcagcgagctggtcaagcaccacctgtgggtgctgtggaccgactacttcaag
cccccgcacttcgagaagtacccgcagctgcacgagctgttcaacaaggccaccaaggcc
gcgggtgccggcggcaccaaggcgtccatggacccggccaagggccaggagctgctggac
ctgatcgccgagatcgacaagatcttctgggagaccaaggcggcctga

DBGET integrated database retrieval system