KEGG   Kutzneria albida: KALB_8052Help
Entry
KALB_8052         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kal  Kutzneria albida
Pathway
kal00020  Citrate cycle (TCA cycle)
kal00480  Glutathione metabolism
kal01100  Metabolic pathways
kal01110  Biosynthesis of secondary metabolites
kal01120  Microbial metabolism in diverse environments
kal01130  Biosynthesis of antibiotics
kal01200  Carbon metabolism
kal01210  2-Oxocarboxylic acid metabolism
kal01230  Biosynthesis of amino acids
Module
kal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kal_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KALB_8052
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KALB_8052
Enzymes [BR:kal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KALB_8052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHI01410
UniProt: W5WTC9
LinkDB All DBs
Position
complement(9054926..9056149)
Genome map
AA seq 407 aa AA seqDB search
MGKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLDYYDLGIEHRDATDDQVTIDS
ANAIKRHGVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGPGELTITFTPADGSEPIQHVVANYPEGGGVAM
GMFNFRKSIEDFARASFSYGLQRNYPVYMSTKNTILKAYDGMFKDVFQEIFDAEFKAEFD
SKGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTGGLKHRGKLDGTPAVTGFAEALE
QVVISTVESGSMTKDLALLVGPDQAWQTTEDFLGTLDENLQKRMASS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggtcgaggggaccgtcgtcgagctcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccgtacctcgacgtgaacctggac
tactacgacctgggcatcgagcaccgggacgccaccgacgaccaggtcaccatcgactcc
gccaacgccatcaagcggcacggcgtgggcgtcaagtgcgcgaccatcaccccggacgag
gcccgcgtcgaggagttcggcctcaagaagatgtgggtctcgcccaacggcacgatccgc
aacatcctgggcggcgtcgtgttccgcgagccgatcatcatctcgaacatcccgcgactg
gtgcccggctggaccaagccgatcatcatcggccgccacgcgcacggcgaccagtacaag
gccaccaacttcaaggtgcccggccccggtgagctgaccatcaccttcaccccggccgac
ggctccgagccgatccagcacgtggtggcgaactaccccgagggcggcggcgtcgccatg
ggcatgttcaacttccgcaagtccatcgaggacttcgcgcgcgcctcgttctcctacggc
ctgcagcggaactaccccgtctacatgtcgaccaagaacacgatcctcaaggcctacgac
ggcatgttcaaggacgtgttccaggagatcttcgacgccgagttcaaggccgagttcgac
agcaagggcctgacctacgagcaccgcctgatcgacgacatggtggccgccgccatgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggcctgatgacctccgtgctgatgaccccggacggc
aagaccgtcgaggccgaggccgcgcacggcacggtgacccggcactaccgccagcaccag
cagggcaagcccacctccaccaacccgatcgcctcgatctacgcgtggaccggtggcctc
aagcaccgcggcaagctggacggcaccccggccgtcaccggcttcgccgaggccctggag
caggtcgtcatctccaccgtggagagcggcagcatgaccaaggacctggccctgctggtg
ggcccggaccaggcgtggcagaccaccgaggacttcctcggcacgctggacgagaacctg
cagaagcgcatggcgtcctcctga

DBGET integrated database retrieval system