KEGG   Kitasatospora aureofaciens: B6264_07295Help
Entry
B6264_07295       CDS       T05021                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
kau  Kitasatospora aureofaciens
Brite
KEGG Orthology (KO) [BR:kau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B6264_07295
Enzymes [BR:kau01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B6264_07295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ARF78747
UniProt: A0A1E7MZM3
LinkDB All DBs
Position
1718999..1719394
Genome map
AA seq 131 aa AA seqDB search
MFSRLFAPRATAHAHCDLPCGVYDPAQAKLEAESVKATQEKYQANEDPHFRARAIIIKEQ
RAEAVKHHISVLWSDYFKAPHFEKYPQLHKLINDTLKAASAAKASTDPATGQALLDLIAE
VDKIFWETKQA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcgtctgtttgcaccgcgtgccaccgctcacgcccactgcgacctgccgtgc
ggtgtgtacgacccggcgcaggccaagctggaggccgagtcggtcaaggccacccaggag
aagtaccaggccaacgaggacccgcacttccgcgcccgcgccatcatcatcaaggagcag
cgcgccgaggccgtcaagcaccacatctcggtgctgtggagcgactacttcaaggcgccg
cacttcgagaagtacccgcagctgcacaagctgatcaacgacaccctgaaggccgcctcg
gccgccaaggcgtccacggacccggccaccggccaggccctgctggacctgatcgccgag
gtcgacaagatcttctgggagaccaagcaggcctga

DBGET integrated database retrieval system