KEGG   Kitasatospora aureofaciens: B6264_18650Help
Entry
B6264_18650       CDS       T05021                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00500  Starch and sucrose metabolism
kau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B6264_18650
Enzymes [BR:kau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B6264_18650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: ARF80656
UniProt: A0A1E7MYN3
LinkDB All DBs
Position
4243294..4245030
Genome map
AA seq 578 aa AA seqDB search
MVTTAPTRRAARAAGALAASAALALSLAGTLGAPAAQASPPANNGKDVTATLFEWRFDSV
AQACTTTLGPKGYGFVEVSPPQEHIQGPQWWTSYQPVSYQIAGRLGDRASFKNMVDTCHA
AGVKVIADAVINHMSAGSGTGTGGTVYTKYNYPGTYRDADFHTCRQPITNYQDRTNVQDC
ELVNLADLDTGSASVQTTIAHYLDDLGSLGVDGYRIDAAKHIAATDLAAIKARMANPNAY
WVQEVIYGAGEPIQPTEYTGNGDVDEFRVGTDLKRVFTSDKLANLGNWGASWGYLPSNQA
RSFVDNWDTERNGSTLNYTYGNTYTLANVFLLASTYGSPNIYSGYSFSNNDDGPPNGGTV
NACYQDGWNCTHAWRQIANMVGFRNAVAGTGVTDWWSDGNNAIAFGRGNRGYVAINHEGG
AITRTFQTGLPAGTYCDVQHGDPQPGGGCTGPTYQVGANGQFTATVGAGDAVALYVQPGT
TVSGASFNVNATTAYGQSVYVVGDVPALGGWDPAKALPLSSAGYPVWSLALSLPGGTSFQ
YKYVIKDAGGAVTWESGANRTATAPGSGNVTLNDTWRP
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaccaccgcccccacccgccgggccgcccgcgcggccggcgcactcgccgcctcc
gcggccctcgcactctcgctcgccgggaccctcggcgcccccgccgcccaggcctccccg
cccgcgaacaacggcaaggacgtcaccgccaccctcttcgagtggcgcttcgactcggtc
gcccaggcctgcaccaccaccctcggccccaagggctacggcttcgtcgaggtctcgccg
ccccaggagcacatccagggcccgcagtggtggacctcctaccagcccgtcagctaccag
atcgccggacggctcggcgaccgggcctccttcaagaacatggtcgacacctgccacgcg
gccggggtcaaggtgatcgccgacgcggtgatcaaccacatgtcggccggctccggcacc
ggaaccggcggcacggtgtacaccaagtacaactaccccggcacctaccgggacgcggac
ttccacacctgccgccagccgatcaccaactaccaggaccgcaccaacgtgcaggactgc
gagctggtcaacctcgcggacctggacaccggcagcgcctccgtccagaccaccatcgcc
cactacctggacgacctcggctcgctcggcgtcgacggctaccggatcgacgccgccaag
cacatcgccgccaccgacctggccgccatcaaggcccggatggccaaccccaacgcctac
tgggtgcaggaggtcatctacggcgccggcgaaccgatccagcccaccgagtacaccggc
aacggcgacgtcgacgagttccgggtcggcaccgacctcaagcgcgtcttcaccagcgac
aagctcgccaacctcggcaactggggcgcctcctggggctacctgccgagcaaccaggcg
cgcagcttcgtcgacaactgggacaccgagcgcaacggttccaccctcaactacacctac
ggcaacacctacacactggccaacgtcttcctgctggcctccacgtacggctcgcccaac
atctactccggctacagcttcagcaacaacgacgacggcccgccgaacggcggcaccgtc
aacgcctgctaccaggacggctggaactgcacccacgcctggcggcagatcgccaacatg
gtcggcttccgcaacgccgtagcgggcaccggggtgaccgactggtggtccgacggaaac
aacgcgatcgccttcggccggggcaaccggggctacgtcgcgatcaaccacgagggcggc
gcgatcacccggaccttccagaccgggctgccggccgggacgtactgcgacgtccagcac
ggcgacccgcagccgggcggcggctgcaccggcccgacgtaccaggtcggcgccaacggg
cagttcaccgcgacggtcggcgcgggcgacgcggtcgcgctgtacgtccagccgggtacg
acggtctccggcgcctcgttcaacgtcaacgcgaccaccgcgtacggacagagcgtctac
gtggtcggcgacgtcccggcgctcggcggctgggacccggccaaggcgctgccgctctcc
tcggccggctaccccgtctggtcgctcgcgctctcgctgccgggcggcacgtccttccag
tacaagtacgtcatcaaggacgcgggcggggcggtgacctgggagtccggcgccaaccgg
acggcgaccgcaccgggctcggggaacgtcacgctgaacgacacctggcggccgtag

DBGET integrated database retrieval system