KEGG   Kitasatospora aureofaciens: B6264_19545Help
Entry
B6264_19545       CDS       T05021                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00010  Glycolysis / Gluconeogenesis
kau00053  Ascorbate and aldarate metabolism
kau00071  Fatty acid degradation
kau00280  Valine, leucine and isoleucine degradation
kau00310  Lysine degradation
kau00330  Arginine and proline metabolism
kau00340  Histidine metabolism
kau00380  Tryptophan metabolism
kau00410  beta-Alanine metabolism
kau00561  Glycerolipid metabolism
kau00620  Pyruvate metabolism
kau00625  Chloroalkane and chloroalkene degradation
kau00903  Limonene and pinene degradation
kau01100  Metabolic pathways
kau01110  Biosynthesis of secondary metabolites
kau01120  Microbial metabolism in diverse environments
kau01130  Biosynthesis of antibiotics
Module
kau_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B6264_19545
   00053 Ascorbate and aldarate metabolism
    B6264_19545
   00620 Pyruvate metabolism
    B6264_19545
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B6264_19545
   00561 Glycerolipid metabolism
    B6264_19545
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B6264_19545
   00310 Lysine degradation
    B6264_19545
   00330 Arginine and proline metabolism
    B6264_19545
   00340 Histidine metabolism
    B6264_19545
   00380 Tryptophan metabolism
    B6264_19545
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B6264_19545
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B6264_19545
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B6264_19545
Enzymes [BR:kau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     B6264_19545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARF80809
UniProt: A0A1E7N585
LinkDB All DBs
Position
4438388..4439845
Genome map
AA seq 485 aa AA seqDB search
MSYFSELALQYIDGEWCGGSGSWDIVDVDPYTGDKLATITVATVAEVDRAYRAAERAQRG
WAATNPYQRRLVFERALRLVEERQDEIARAITAELGGTALKAGFELSLVKDMLRECLHLS
VASEGRLLPSTAPGKENRLHRLPVGVVGVISPFNFPLFLALKAVAPALALGNGVVLKPHQ
ETPVVGGSLIAKLFEDAGLPPGLLNVVITDIAEIGDSFLEHPVPKVISFTGSDQVGRHVA
TVAAAHFKRTVLELGGNSALIVLDDADLDYAVDAAVFSRFVHQGQVCMAANRVLVDRSVL
AEFTEKFVAKTASLTVGDPKDPATHIGPLINSVQADAINAQVDQAIAAGATALLRGDTTG
SLMAPTVLTDLAEDAPILQRELFGPVALLVPFDGEDEAVRIANDTPFGLSGAVHTADAER
GVRIAQRIETGMIHVNGGTIADEPGVPFGGEKHSGVGRLNGESTVDAFTTVKWISVQHGR
APFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacttctccgagttggcgctgcagtacatcgacggcgaatggtgcggcggcagc
ggctcctgggacatcgtcgacgtcgacccgtacaccggtgacaagctggccaccatcacc
gtggccaccgtcgccgaggtcgaccgggcctaccgtgccgccgagcgcgcccagcgcggc
tgggccgccaccaacccgtaccagcgccggctggtcttcgagcgcgcgctgcggctggtc
gaggagcgccaggacgagatcgcccgggcgatcacggccgagctcggcggcaccgcgctc
aaggccggcttcgagctgtccctggtcaaggacatgctgcgggagtgcctgcacctgtcg
gtggcctccgaggggcggctgctgccctccaccgcgcccggcaaggagaaccgcctgcac
cggctgccggtcggcgtggtcggcgtgatcagcccgttcaacttcccgctgttcctggcc
ctcaaggccgtcgccccggcgctcgcgctcggcaacggcgtcgtgctcaagccgcaccag
gagaccccggtcgtcggcggcagcctgatcgccaagctcttcgaggacgccggactgccg
cccggcctgctgaacgtggtcatcaccgacatcgcggagatcggggacagcttcctggag
cacccggtgcccaaggtgatctccttcaccggctccgaccaggtcggccgacacgtcgcc
accgtcgccgccgcccacttcaagcggacggtgctggaactcggcggaaacagtgcgctg
atcgtgctggacgacgccgacctcgactacgccgtggacgcggccgtgttcagccgcttc
gtccaccagggccaggtctgcatggccgccaaccgggtgctggtcgaccgcagcgtgctc
gccgagttcaccgagaagttcgtcgccaagaccgcctcgctgaccgtcggcgacccgaag
gacccggccacccacatcggcccgctgatcaactccgtccaggccgacgcgatcaacgcc
caggtcgaccaggcgatcgcggccggcgccaccgcgctgctgcgcggcgacacgaccggc
agcctcatggcgcccaccgtgctcaccgacctggccgaggacgcgcccatcctgcagcgc
gaactcttcggcccggtggccctcctggtgcccttcgacggcgaggacgaggccgtccgg
atcgccaacgacacgcccttcggactcagcggcgcggtgcacaccgcggacgccgagcgc
ggggtccggatcgcccagcggatcgagaccggcatgatccacgtcaacggcgggacgatc
gcggacgagcccggtgtgccgttcggcggggagaagcactccggggtcggccgcctcaac
ggagagtccaccgtggacgccttcaccacggtgaagtggatctcggtgcagcacgggcgg
gcgccgttcccgttctag

DBGET integrated database retrieval system