KEGG   Kitasatospora aureofaciens: B6264_21810Help
Entry
B6264_21810       CDS       T05021                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kau01100  Metabolic pathways
kau01110  Biosynthesis of secondary metabolites
kau01130  Biosynthesis of antibiotics
kau01230  Biosynthesis of amino acids
Module
kau_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B6264_21810
Enzymes [BR:kau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     B6264_21810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin AAA_28 AAA AAA_5 Cytidylate_kin2 AAA_22 AAA_16 RuvB_N AAA_24 AAA_17 KTI12 ABC_tran AAA_30 AAA_21 CPT Rad17 RNA_helicase Zeta_toxin Fe-ADH AAA_29 MMR_HSR1 Ploopntkinase3 Mg_chelatase cobW AAA_23 SMC_N
Motif
Other DBs
NCBI-ProteinID: ARF81184
UniProt: A0A1E7NDJ3
LinkDB All DBs
Position
4904600..4905121
Genome map
AA seq 173 aa AA seqDB search
MTSPIVVLVGPPGSGKSTVGRALAERLGVGFRDTDADIEALAGKPIPEIFIDEGEPHFRE
LEVRAVRAAAEGHGGVLALGGGAVMAEATRELLRELPVVFLEVPLGDAVKRVGLDAPRPL
LAVNPRARWRELMEARRPLYLEVATAVVDTADRTPGQVADAVLEALELKTPHD
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgccgatcgtggtgctggtcggcccgcccggcagtggcaagtccaccgtcggg
cgggccctggccgagcgcctgggcgtcggcttccgggacaccgacgccgacatcgaggcg
ctggccggcaagcccatcccggagatcttcatcgacgagggcgagccgcacttccgcgag
ctggaggtccgcgccgtgcgcgcggccgccgagggacacggcggagtgctggcgctcggc
ggcggcgcggtgatggccgaggccacccgtgagctgctgcgcgagctgccggtggtcttc
ctggaggtcccgctcggcgacgcggtcaagcgggtcggcctggacgccccgcgcccgctg
ctggccgtcaacccgcgggcccgctggcgcgagctgatggaggcccgccgccccctctac
ctggaggtggccaccgccgtcgtcgacaccgccgaccgcacccccgggcaggtcgcggac
gccgtactggaagcactggagctgaagaccccccatgactga

DBGET integrated database retrieval system