KEGG   Kitasatospora aureofaciens: B6264_23590Help
Entry
B6264_23590       CDS       T05021                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
kau  Kitasatospora aureofaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ARF81498
UniProt: A0A1E7N7K3
LinkDB All DBs
Position
5305506..5306567
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVAPMLAKSVAKIPPGMQYEAKWDGFRTIVFRDGDEVELGSRTGKPLTRYFPE
LVEAFRRELPPRCVLDGEVVIARDGRLRFEELLERIHPAASRVRLLAERTPASFVAFDLL
ALGDDPLVDEPLSVRRPALEAALRGAADPVFTAPASTDREVAQSWFAEFEGAGLDGVVAK
PLDQPYRPGERTMYKIKHERTADCVVAGYREHKSGPVVGSLLLGIYDEQGKLQHVGVCAA
FPMARRRQLVEELAPLRMDDLAQHPWGAWAEEAAHAEGRLPGAVSRWTGGKDLSWIALRP
ERVIEVAYDHMEGSRFRHTAQFRRWRPDRTPESCTYEQLEEPVSYDLGQVLGI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgatgccgccggtggcgccgatgctcgccaagtcggtggccaagatc
ccgccggggatgcagtacgaggccaagtgggacggcttccgcacgatcgtcttccgcgac
ggcgacgaggtggagctcggcagccgcaccggcaaaccgctgaccaggtacttccccgaa
ctggtggaggccttccggcgggagctgccgccgcgctgcgtgctggacggcgaggtggtg
atcgcccgggacgggcggctgcgcttcgaggagctgctggagcggatccacccggccgcg
agccgggtgaggctgctcgccgagcggacgcccgcctccttcgtcgccttcgacctgctc
gccctgggtgacgacccgctcgtcgacgagcccctctcggttcgccgcccggccctggag
gcggcgctgcgcggggcggccgacccggtgttcaccgcccccgcctccaccgaccgcgaa
gtcgcgcagagctggttcgccgagttcgagggtgccgggctggacggggtggtggccaag
ccgctggaccagccgtaccggccgggggagcggaccatgtacaagatcaagcacgagcgc
acggccgactgcgtggtggccggctaccgcgagcacaagagcgggccggtggtcggctcg
ctgctgctcggcatctacgacgagcagggcaagctccagcacgtcggcgtctgcgcggcc
ttcccgatggcccgccgccgccagctggtcgaggaactggccccgctccggatggacgac
ctggcccaacacccttggggcgcctgggcggaggaggccgcgcacgccgagggccggctg
ccgggggcggtcagccgctggaccggcggcaaggacctgtcctggatcgcgctgcgcccc
gagcgggtgatcgaggtggcctacgaccacatggagggcagccgtttccggcacaccgcg
cagttccgccgctggcggccggaccgcacgccggagagctgcacctacgagcagttggag
gagccggtctcgtacgatctcggccaggtgttggggatctga

DBGET integrated database retrieval system