KEGG   Kitasatospora aureofaciens: B6264_23600Help
Entry
B6264_23600       CDS       T05021                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00260  Glycine, serine and threonine metabolism
kau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B6264_23600
Enzymes [BR:kau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     B6264_23600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_oxidored AlaDh_PNT_C FAD_binding_3 HI0933_like ADH_zinc_N_2 FAD_binding_2 Pyr_redox_2 Pyr_redox_3 I-EGF_1
Motif
Other DBs
NCBI-ProteinID: ARF81499
UniProt: A0A1E7N7J2
LinkDB All DBs
Position
5308583..5309611
Genome map
AA seq 342 aa AA seqDB search
MKALVKHNAEPGLWLMDVPKPEIGPGEVLIKVLRTGICGTDLHIRKWDGWAQQTIRTPLV
LGHEFVGEVAEIGAGVADIAIGDLVSGEGHLVCGKCRNCLAGRRHLCRNTIGLGVNRDGA
FAEYVALPASNVWVHRVPVDLDVAAIFDPFGNAVHTALSFPLVGEDVLVTGAGPIGIMAA
AVAKHAGARSVMITDVSPYRLDLAREVGVTLALNVAEHTIEEGQQKLGLREGFDVGLEMS
GRPEAMQSMIANMTHGGKIAMLGLPAEQFPVDWASVVTSMITIKGIYGREMFETWYAMSV
LLEGGLDLSPVITGRYAATDFEAAFDDAASGNCGKIILDWTA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcactcgtcaagcacaacgccgagcccgggctctggctgatggacgtccccaag
ccggagatcggccccggcgaggtgctgatcaaggtgctgcggaccggcatctgcggcacc
gacctgcacatccgcaagtgggacggctgggcgcagcagaccatcaggaccccgctggtc
ctcggccacgagttcgtcggcgaggtcgccgagatcggcgccggcgtcgcggacatcgcg
atcggcgacctggtcagcggcgagggccacctggtctgcggcaagtgccgcaactgcctg
gccggccgccgccacctgtgccgcaacaccatcggcctgggcgtcaaccgcgacggcgcc
ttcgccgagtacgtggcgctgcccgcctccaacgtctgggtgcaccgggtgccggtcgac
ctcgacgtggccgcgatcttcgaccccttcggcaacgccgtgcacaccgcgctgtccttc
ccgctggtcggcgaggacgtgctggtcaccggcgccggcccgatcggcatcatggccgcc
gccgtcgccaagcacgccggcgcccgcagcgtgatgatcaccgacgtgtccccgtaccgc
ctcgacctggcccgcgaggtcggcgtgacgctggcgctcaacgtcgccgagcacaccatc
gaggagggccagcagaagctgggcctgcgcgagggcttcgacgtcggcctggagatgtcc
ggtcgccccgaggcgatgcagtcgatgatcgccaacatgacccacggcgggaagatcgcc
atgctgggcctgccggccgagcagttcccggtcgactgggcctcggtcgtcacctcgatg
atcaccatcaagggcatctacggccgcgagatgttcgagacctggtacgcgatgtccgtg
ctgctggagggcggcctggacctcagcccggtgatcaccggccgctacgccgccaccgac
ttcgaggcggccttcgacgacgccgcgagcggcaactgcggcaagatcatcctcgactgg
accgcctga

DBGET integrated database retrieval system