KEGG   Kitasatospora aureofaciens: B6264_25235Help
Entry
B6264_25235       CDS       T05021                                 

Definition
(GenBank) acyl transferase
Organism
kau  Kitasatospora aureofaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N ADH_zinc_N_2 adh_short_C2 ADH_zinc_N Epimerase Docking PKS_DE GDP_Man_Dehyd Polysacc_synt_2 SAT NmrA ADH_N
Motif
Other DBs
NCBI-ProteinID: ARF81760
UniProt: A0A1V0VWX8
LinkDB All DBs
Position
5726188..5742762
Genome map
AA seq 5524 aa AA seqDB search
MSNEDKLRDYLKRAIADLQETREQLHEVTEQQREPIAVVGMACRLPGGVASPEELWELVR
DGVDAVSDFPADRGWDLPEGSVTSRQSGFLHDAGDFDADFFGISPREALAMDPQQRLMLE
TAWEAVERAGIDPDSLHGTRTGVFVGAGHGGYDSASTARGRIDGDASGHLLTGNTVSIAS
GRISYVLGLEGPAVTVDTACSSSLVALHLAVQSLRRGECTLALAGGVTVMSTPQMFTEFS
RQGGLAADGRCKPFAAAADGTAWGEGAAVLLVERLSDARRNGHPVLAVVRGSAVNQDGAS
NGLTAPNGPSQQRVIRAALADAGVPAREVDVVEAHGTGTRLGDPIEAAALLATYGQNRER
PLLIGALKSNTGHTQAASGVAGVIKTVLAMRHGLLPRTLHLDEPTPHVDWTAGSAELLAE
ARGWPETGRPRRAGVSSFGVSGTNAHVVLEAVPEPVEAEPAAEELPGAVLPWVLSARGDA
ALRAQAGRLAAHLRTHRPLAPADVAHSLATARAGLEHRAVVLGHGPEERLRALDALAGGE
SAPDVVLGTVDKGATAFLFSGQGSQRLGMGRELYARFPVFAEAFDAVCAELDLPLREVVW
GEDAELLNRTDFAQAGLFAVEVALFRLVESLGVRPEFVAGHSIGEIAAAHVAGVFSLSDA
CTLVAARGRLMQALPSGGAMLAVQATEEEVRPLLGESVSIAAVNGPSSVVVSGTEEAVAA
IEAHFADRKTSRLRVSHAFHSALMDPMLDDFRTVLNGLTYLAPSIPLVSNLTGELVTGTT
DADYWVRHVREPVRFADGLRTLHDQGVTRLLELGPDGVLSAMAAETLPGDAAPVALLRKD
RPEETALLAALARLHVRGAGPDWTAVLAGTGGRRTELPTYAFQRQRYWLPGLHQREAGTP
TADPVEDSFWAAVEAGDLQEASAVLGIAEEATEASLDRLLPVLSAWRGQRRLLSTLDSWT
YRTTWVPLPGPTDAVPTGRWLAVLPQGPASTPSTEGTGAEGLTDGTGDTEAVAGAPAGDW
PAAVLAALAARGLRIERVPGAHALAARLAGGADEPVAGVLSFLAADGRPDPEHPEVPGYL
PATVDLLRALEAAGGPARLWCLTRGAVAADASDRVAAPEQAQLWGLGRVAALEHPQRWGG
LIDLPATTCSRTAAQLVGVLAQAAEQQTAAHGATGYRAAGQRPVEDQVALRASGARARRL
IRAAAPVPPAPAAPGAADGTGWAAPAGTILITGGTGALGAHVARWLAGAGAEHLLLLGRR
GPQAPGAGELGEELAALGTRVTVVACDAADREALAAVLAAVPAELPLTGVVHAAGVLDDG
VLDGLTAERFTSVLRAKAVPARHLHELTAGQDLALFVLFSSITGVLGNPGQANYAAANAY
LDALAEHRRAAGRPVTCLAWGPWAGGGMAGDHPALTGRMRRSGLTPMDPAPAVAALGRAL
GAGASGLTVADVDWNVLAPALTAARPSALIAELPEARRAGAPAVGAQERSPLAGRLSGRD
AAERQRVLLELVRTEAAAVLGHTGPATVDAARAFRDLGFDSLTAVELRNRLAAATGLGLP
ATLLFDHPTPSALAGHLRTELDGTEAGPAAAATVTAADDDEPIAIVAMACRFPGGVDSPE
GLWELLAEGRDAVGPFPADRGWDTERLHHPDPDHEGTSYVAEGAFVTGVADFDADFFGIS
PREALAMDPQQRLMLETAWEAVERAGIDAGALRGSRTGVFVGSNFQDYQVVLDAAREGVA
GHVMTGNAASVLSGRIAYTLGLEGPAVTVDTACSSSLVALHLAVQALRRGECALALAGGV
TVMATPQVFVEFSRQRGLAPDGRCKPFAAAADGTGWSEGAGVLLVERLSDARRNGHPVLA
VVRGSAVNQDGASNGLTAPNGPSQQRVIRAALADAGLSPAEVDAVEAHGTGTRLGDPIEA
QALLATYGQERELPLLLGSVKSNLGHTQAAAGVAGVIRTVLALRHGELPKSLHIDTPTPQ
VDWTAGAVELLAEARPWPETGRPRRAGVSSFGVSGTNAHVILEAAPAAEPASEPVPEFPP
APERGSAPQPEPAAPARPLPWLLSARTPGAVREQARRLAARVRAAGPAPDDVAHALATTR
AALEHRAAVVAPDLDGLLGGLDALAEGRAVPTVLEGRSAGDGDPVLVFPGQGSQWAGMAL
ELLDTAPEFARRFAECEAALAPYTGWTAGAVLRGDAGAPGLDRVEVVQPVLFAVMVSLAE
LWGSYGVRPAAVLGHSQGEIAAACVAGALSLDDAARVVALRSRALRQLAGLGGMVSVAEP
VTAVRERLGRWRELISVAAVNGPGSVVVSGEPGALDELLADCERSGVRARRIPVDYASHS
AQVERIERELLDLLAPIAPRSADIPFCSTVTGAVIDTAGLDAAYWYRNLRRTVEFEQATR
TLLAAGHQLFVEVSPHPVVTTGLQETIEDAGLPAAALGTLRRDEGGLGRFLLALADARVH
GARVDWQRCFAGADPRPVELPTYPFQRQRYWPRPGAAGGDVTTAGLAAPEHPLLGAAVEL
ARDGGLLATARWSLHTHPWLADHAVAGTLVVPGAALVEAVVRAGDELGCGRIEELTLHAP
VLLPERGALQVQIELGAPDGAGLRPVAVHTRPAEADAPDAWTRHAEGRVGPAGAEPAPES
AAWPPAGAEPVDLEGWYPGLRADGYGYGPVFRGVRAAWLLGDTVHAEVELPEPARPDAPR
YGLHPALLDAALHPAGLGPLRGRPGLPFAWTGVTLHAAGATALRVTLTPAGPDAVHVRMT
DPAGRPVATVDALAVRPLTGAALDPAARVAREALHHLDWPALPAPQAAPAAARWTVLGEP
PAHAAALAEAGISFGPGGGVVLHQATGPHPRAALEGALAVLRDHLAAGAGAGAGAGAGVD
ADGAGGGDATLLVVTRRAVATDPAEDVHDLPAAAVHGLVGSAQNEHPGRIVLADLDDDPA
SWRTLPAALAAALAAGEPRLALRHGTVHAPRLVHAHTAAPLPVPDGPWRLDVRTKGTVDN
LELLPCPDAAEPLADGQVRIEVRAAGLNFRDVLNALDMYPGGARHLGSEAAGIVREAGPG
VTGLAVGDRVMGMVPGGFGPLAVTDHRLLTRIPQDWTFAQAASVPVVFLTAYYALRDLAG
LRAGERLLVHAATGGVGMAAVQLARLWGAEVYGTASEAKQHLLRADGLPGTAIASSRTLD
FEERFRTATGGAGVDVVLNSLAGEYVDASLRLLAPGGRLIEMGKTDVRDAEEVAAAHGGA
RYRAFDLQEAGPERIGQMLADLVELFEQGALRPLPLTCWDVTRAREAFRHMAQARHTGKI
VLTVPRPWDREGTVLITGGTGTLGGELARHLVTEHGVRHLLLAGRRGLQAPGARELSEEL
AASGAEVTVAACDTSDRAAVAALLAGVPARHPLTAVVHAAGILDDGVVDALTPERLAVVL
RPKADAAHHLHDLTRGLDLADFVLFSSAAGVFGSPGQGGYAAANSWLDALAQHRRVCGLP
ATSLAWGLWAQASTMTAHLGATDRARAEQSGALTLDTADGLALFDAALAARRALLVPVRL
DTVALRGRGPAELPPLLRDLVRTRARRTAQSGPAAGGLPARLAALGPAERHAALLDLVSG
CTAAVLGHGSAEQVHATRPFRDLGLDSLTAVELRNRLNTATGLRLPATLVFDHPTPGALA
GHLAEGLGGRTAGPAAGTAPGAADEPVAIVGMACRFPGAVTSPEELWTLLAGGTDAVAGF
PTDRGWDLERLYDGIPDHPDSSRTRQGGFLDAAAWFDADFFGVSPNEALAMDPQQRLLLE
TAWEAVERAGIDPGTLRGSRTGVFAGLSSSDYLDRVARIPEEAAPYVNTGNAVSVASGRV
AYTLGLEGPAVTVDTACSSSLVALHLAVRALRGGECSLALAGGVTVMSTPMIPVDFARQR
GLAADGRCKPFAEAADGTGFSEGVGVLLVERLSDARRNGHPVLAVVRGSAVNQDGASNGL
SAPNGPSQQRVIRAALADAGLSPAEVDAVEAHGTGTRLGDPIEAQALLAVYGQERELPLL
LGSVKSNLGHTQAAAGVAGVIRTVLALRHGELPKSLHIDTPTSHVDWSQGAVELLTEARA
WPETGRPRRAGVSSFGLSGTNAHVLLEAASESEGVQPGAVEPGAVEPGAVPAGAPEPGAP
ESGALPWLLSARSAQALRGQARALLGHLDAAAPAPLDLAHSLATRRALLEHRAAVIGTGP
EELRAGLTALADGAPAPGVVTGRHAAGRDRRVVLLFPGQGSQWAGMGAELLDSSTEFAET
IAACEQALAPWTDWSLSAVLRGAPDAPALDRVDVAQPALWATMIALATCWQAHGVTPAAV
LGHSQGEIAAACVAGALSLEDGAKVVALRSLAIARALSGHGGMVSVPQTHAEVLARIEPY
DGRISVAAANGPAGVVVSGEPEALDRLLAGCEHDGVRAKRIPVDYASHSAQVERIERTLL
TELHGITTREARIPFFSTVTADWLGDTPLDARYWYRNLRRTVRLEESVRALLAQGHDAFL
ECSPHPVLAMAVEDTAADAGARAVVLGTVRREDGGPARLLTSLAEAHVSGVRIDWAPALA
GGRPVDLPTYAFQRRRYWLARDTAAAGTTDPSGLDRAVHLAGGDTVLLTGRIGTATHPWT
ADHQVRGTAVVPGTALLDWAVRAGDEAGCPAVAELTEHSPLVLPEHGTLDLQLTVGPAGE
DGRRPLTVHARRTDAPGSTPWTRHAAGTLAPAGAPSAARPASHDALPPDTGTPTDTHAGP
DGYGERFRTVRSLVRRGEERYAEVALAEEHRAEAAGFRLHPALLQGLLAATGAGADAGAA
AQPADWRGVTLHATGATRLRVRLTPGPDGSHALSAVDPDGAPVLTVEAVTARPIAADRLG
PEPEPLYAVEWCPVTPGEPRGTLALLGADPAATDPSVSVPSATDPGPAAAPGAPGYADLA
ELTAALDAGEPAPDTVVHRLTTADGDDPVTATHQAVRAAHRLARAWLAEPRLAGSRLALL
TRGAEAAAPGEDVTSLAQAAVHGLIRSAQSEEPGRFLLLDLDDDPASAAALSAALAVPDE
PRLAVRHGRVTAPRLRPLPVPGPGQTSTDRPAWSWNPAGTVLITGGTGTLGALVARHLIT
AHGVRHLLLTGRRGPAAPGAEALRDELTALGATVTVAACDTADRAALDALLATVPAEHPL
TGVVHAAGVLHDGLLANLTDEQLTEVLRPKADAAWHLHRATAHLDLSAFVLFSSFAATAG
GPAQANYAAANAFLDALAHRRRAESRPAVSLGWGYWGESSAMTSTLDAVDIARFARSGML
PLPAAQGLALLDAASTVDRPHLAPVRLDRHALATAGAPPLFADLLPRRATARPTAAGTAT
GGDRGVPDRLAGLGAAQQEQLLQSLVIGHLAAVLGHAEPDALEPERGFLDHGMSSLAAVE
LRNRLNAELGLRLPTTTVFDHPSPVALAGRLRELLGAPTDAAAPARPVFAELDVLETALT
GALDSAALDPASRARLLTRLKSLQWRLDDGATEPADGDSEPDAGLDGSTDDEMFDLIDRE
LGLA
NT seq 16575 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaagacaagctccgcgactacctgaagcgggcgatcgccgatctccaggag
acccgcgagcagctgcacgaggtgaccgagcagcagcgggaaccgatcgcggtcgtcggg
atggcctgccggctgccgggcggggtcgcctcgcccgaggagctgtgggaactggtccgg
gacggcgtcgacgcggtgtccgacttcccggcggaccgcggctgggacctccccgagggc
tccgtcacctcccggcagagcggattcctgcacgacgccggggacttcgacgcggacttc
ttcggcatctcgccgcgcgaggcgctggccatggacccgcagcagcggctgatgctggag
accgcgtgggaggcggtcgagcgggccggcatcgacccggactcgctgcacggcactcgg
accggggtgttcgtcggggccggccacggcggctacgacagcgcctccaccgcccgcggg
cggatcgacggtgacgcctccgggcacctgctcaccggcaacaccgtcagcatcgcctcc
ggccggatctcctacgtcctcgggctggaaggcccggccgtcaccgtcgacacggcctgc
tcgtcctcgctggtcgccctgcacctggccgtgcagtcgctgcgccgcggggagtgcacc
ctcgcgctggccggcggagtgacggtgatgtccaccccgcagatgttcaccgagttctcc
cgtcagggcggcctggccgccgacggacggtgcaagcccttcgcggccgcggcggacggt
accgcctggggtgagggcgcggccgtgctgctggtcgaacggctctcggacgcccggcgg
aacgggcacccggtgctggcggtggtgcgcggcagcgccgtcaaccaggacggcgcgtcc
aacggcctgacggcgccgaacggcccgtcccagcagcgggtgatccgggcggccctggcc
gacgccggggtgccggcccgcgaggtcgacgtggtcgaggcgcacggcaccgggacccgg
ctgggtgacccgatcgaggctgcggcactgctggccacctacgggcagaaccgtgaacgg
cccctgctgatcggcgcgttgaaatccaacaccgggcacacccaggccgcctccggcgtg
gccggggtgatcaagaccgtgctggccatgcggcacggcctgctcccgcgcaccctccac
ctcgacgagccgaccccgcacgtcgactggaccgccgggtccgccgaactgctcgccgag
gcccgtgggtggccggagaccggacggccgcgccgggccggggtgtcctccttcggggtc
agcggcaccaacgcgcacgtggtgctggaggcggtcccggagccggtggaggccgagccg
gcggcggaggagctgccgggggccgtcctgccctgggtgctgtcggcccgtggtgacgcc
gccctgcgcgcccaggccggacggctggccgcccacctcaggacccaccgtccgctcgcg
ccggcggacgtcgcccactcgctcgcgaccgccagggcggggctggagcaccgggccgtc
gtcctcggccacggcccggaggagcggctgcgcgccctggacgccctggcgggcggggag
agcgcacccgatgtcgtcctggggacggtggacaagggggcgacggcgttcctgttctcc
ggtcaggggtcgcagcggttggggatgggccgggagttgtatgcccggttcccggtgttc
gcggaggctttcgacgcggtgtgtgcggagctggacctgccgctgcgggaggtggtgtgg
ggtgaggacgcggagctgctgaaccggacggacttcgctcaggcggggttgttcgcggtg
gaggtggcgctgttccggctggtggagtcgttgggggtgcggccggagttcgtggctggg
cactcgatcggtgagatcgccgcggcgcacgtggcgggggtgttctcgctgtccgacgcc
tgcaccttggtggccgcccgtggccggctgatgcaggcgctgccctccggtggcgcgatg
ctcgccgtgcaggcgacggaggaggaggtccggccgctgctgggcgagtcggtgtccata
gccgccgtcaacggcccgtcctcggtggtcgtttcgggcacggaggaagcggtcgcggcg
atcgaagcgcacttcgccgaccggaagaccagccgcctgcgggtctcgcacgccttccac
tcggcgctgatggacccgatgctggacgacttccgtaccgtcctcaacggcctgacgtac
ctcgcgccctcgatccccctcgtctccaacctgaccggcgagctggtcaccggcacgacc
gacgcggactactgggtgcgccacgtccgcgagcccgtccgcttcgccgacggcctccgc
accctgcacgaccagggcgtcacccggctcctcgagctcggccccgacggcgtcctcagc
gccatggcggccgaaacgctgcccggcgacgcggcgccggtggccctgctgcgcaaggac
cgccccgaggagaccgccctgctggcggccctcgcccggctgcacgtgcgcggtgccggg
ccggactggacggcggtgctcgccggcaccggcggccgccgcaccgagctgcccacctac
gccttccagcggcagcgctactggctgcccggactccaccagcgggaagccggcacgccc
acggccgacccggtcgaggactccttctgggcggccgtcgaggcgggcgacctgcaggag
gcgtcggcggtgctggggatcgcggaggaggccaccgaggcctcgctcgaccgcctcctg
ccggtgctgtccgcctggcgcgggcagcggcggctgctgagcacgctcgactcctggacc
taccggaccacctgggtaccgctacccggtccgaccgacgccgtgcccaccggccgctgg
ctcgcggtcctgccgcagggcccggcgagcacgccgagcacggagggcacgggggccgaa
gggctcacggacggcaccggggacacggaggccgtggcgggcgcgccggcgggggactgg
cccgccgccgtcctggccgccctggccgcccggggcctgcggatcgaacgggtgccgggg
gcccacgccctggccgcacggctggccgggggagcggacgaaccggtcgccggtgtgctg
tccttcctcgcggccgacggccgcccggacccggaacatcccgaggtccccgggtacctg
cccgcgaccgtcgacctgctgcgggccctggaggccgccggtgggcccgcgcggctctgg
tgcctcacccggggcgccgtcgccgccgacgcctcggaccgggtggccgcgcccgagcag
gcccagctctggggcctcggccgggtcgccgcgctggagcacccccagcgctggggcggc
ctgatcgacctgcccgcgacgacctgctcccggacggcggcccagctggttggcgtgctg
gcccaggccgccgaacagcagaccgccgcgcacggcgccaccggataccgcgccgccgga
cagcggcccgtcgaggaccaggtcgccctgcgcgcctccggtgcccgggcccgtcggctg
atccgcgccgccgcccccgtaccgcccgcccccgccgccccgggagcggccgacgggacg
ggctgggccgcgcccgccggcacgatcctgatcaccggcgggacgggcgcgctcggcgcc
cacgtcgcccggtggctggccggggccggcgcggaacacctgctgctgctcgggcgacgg
ggcccgcaggcccccggggcgggggagctgggcgaggagctggccgcgctcggcacccgg
gtgaccgtcgtcgcctgcgacgcggccgaccgcgaggcgctggcggccgtgctggccgcc
gttccggccgagctgccgctgaccggcgtcgtgcacgcggcgggggtgctcgacgacggg
gtgctggacggactgacggccgagcggttcacctccgtgctgcgggccaaggccgtcccg
gcccggcacctccacgagctgacggccgggcaggacctcgccctgttcgtgctgttctcc
tcgatcaccggggtcctcggcaaccccggccaggccaactacgccgccgccaacgcctac
ctggacgccctggccgagcaccgccgggcggccggccggcccgtcacctgcctggcctgg
ggcccgtgggccggcggcggcatggcgggggaccacccggccctgaccgggcggatgcgg
cgcagcggcctgaccccgatggacccggcgccggccgtggcggcgctgggccgcgcgctc
ggcgccggcgcctccggtctgaccgtggccgacgtggactggaacgtgctcgcccccgcc
ctcaccgccgcccggccgagcgcgctgatcgcggagctgccggaggcccggcgggccggc
gcccccgccgtcggcgcgcaggagcgctccccgctggccgggcggctgtccggccgtgac
gccgcggagcggcaacgcgtgctgctggagttggtgcgcaccgaggccgcggccgtgctg
gggcataccggccccgcgacggtggacgccgcccgggccttccgggacctcggcttcgac
tcgctgaccgccgtcgaactgcgcaaccgcctcgccgccgccaccggtctggggctgccc
gcgaccctgctgttcgaccatccgacgccgtcggccctggccggtcacctgcgcaccgaa
ctggacggcaccgaggcgggaccggcggccgccgccacggtgaccgccgccgacgacgac
gagccgatcgcgatcgtcgcgatggcctgccgcttccccggcggtgtggactcgccggag
ggcctgtgggagctgctcgccgaggggcgggacgcggtgggccccttcccggccgaccgc
ggctgggacaccgagcggctgcaccacccggatccggaccacgagggcaccagctacgtc
gccgagggtgccttcgtcaccggcgtggccgacttcgacgcggacttcttcgggatctcc
ccgcgcgaggcgctggccatggacccgcagcagcggctgatgctggagaccgcgtgggag
gccgtcgagcgggccggcatcgacgccggggcgctgcgcggttcgcggaccggcgtgttc
gtcggctccaacttccaggactaccaggtggtgctggacgcggcccgggagggcgtggcc
gggcacgtgatgaccggcaacgccgcgagcgtcctgtccggccggatcgcctacacgctc
gggctggagggcccggccgtcaccgtcgacacggcgtgctcctcctcgctggtggccctg
cacctggccgtccaggccctgcgccggggcgagtgcgcgctcgccctggccggcggcgtg
acggtgatggccacgccgcaggtgttcgtcgagttctcccggcagcgcgggctggccccg
gacggccgctgcaagcccttcgccgccgcggcggacggcaccggctggtccgagggggcc
ggggtgctgctggtcgagcggctctcggacgcccggcgcaacgggcacccggtgctggcg
gtggtgcgcggcagcgccgtcaaccaggacggcgcctccaatggcctgacggcgccgaac
ggcccgtcccagcagcgggtgatccgggcggccctggccgacgccgggctgtcgcccgcc
gaggtggacgcggtcgaggcgcacggcaccgggacccggctgggcgacccgatcgaggcg
caggcgttgctggcgacgtacgggcaggagcgtgaactcccgctgctgctgggctcggtg
aagtccaacctgggccacacccaggccgccgccggggtcgccggggtgatccggacggtg
ctcgcgctgcggcacggcgaactgccgaagtcgctgcacatcgacacgccgaccccgcag
gtggactggaccgccggcgccgtggaactgctcgcggaggcccggccgtggccggagacc
gggcggccgcgccgggccggggtgtcctccttcggggtcagcggcaccaacgcccacgtg
atcctggaggccgcgccggctgccgagcccgcgtcggagcccgtgcccgagttcccgccc
gcaccggagcgcgggtccgcgccgcagcccgaacccgccgcccccgcccgcccgttgccc
tggctgctgtccgcccgcacccccggggcggtgcgcgagcaggcccgccgcctggccgcc
cgggtgcgcgccgccgggcccgcccccgacgacgtcgcccacgccctggccaccacccgg
gcggccctggagcaccgggccgccgtggtcgcgccggacctggacggtctcctgggcggt
ctggacgcgctggccgagggccgggccgtccccaccgtgctggagggccggagcgcgggc
gacggcgacccggtcctggtgttccccggccagggctcccagtgggccggaatggccctc
gaactgctggacaccgcgccggagttcgcccgccgcttcgccgagtgcgaggccgcgctc
gcgccctacaccggctggacggccggcgcggtgctgcgaggtgacgccggggcacccggc
ctcgaccgggtcgaggtggtgcagccggtgctgttcgccgtcatggtgtcgctggccgag
ctgtggggctcgtacggcgtccggccggctgccgtgctcggccactcccagggcgagatc
gccgccgcctgcgtggccggcgcgctctcgctcgacgacgccgcccgggtggtcgcactg
cgcagccgggcgctgcggcagctggccggcctcggcggcatggtctcggtggccgagccg
gtcaccgccgtccgcgaacggctcggccgctggcgcgagctgatctcggtcgccgccgtc
aacggccccggctcggtggtggtctccggcgaacccggagcgctggacgaactgctcgcc
gactgcgagcggtccggcgtacgggcccgccgcatcccggtcgactacgcctcgcactcc
gcccaggtcgagcggatcgaacgcgagctgctggacctgctggccccgatcgccccgcgc
agcgccgacatcccgttctgctccaccgtcaccggcgcggtcatcgacaccgccgggctc
gacgccgcctactggtaccgcaacctgcgccggaccgtcgagttcgaacaggccacccgc
accctgctggcggccggacaccagctgttcgtcgaggtcagcccgcacccggtggtcacc
accggcctccaggagacgatcgaggacgccggcctgcccgccgccgccctcggcaccctg
cgccgcgacgagggcgggctcggccgcttcctgctcgccctggccgacgcccgggtgcac
ggcgcccgggtggactggcagcgctgcttcgccggtgccgacccccggcccgtcgagctt
ccgacctaccccttccagcggcagcgctactggccgcgcccgggtgccgccggcggcgac
gtgaccacggccggcctcgccgcgccggagcacccgctgctcggcgccgccgtcgagctc
gcccgggacggcggcctgctggccaccgcccgctggtcgctgcacacccacccctggctc
gccgaccacgccgtcgccggcaccctggtcgttcccggcgcggcgctggtcgaggcggtc
gtccgggccggggacgagctgggctgcggccggatcgaggaactgaccctgcacgcgccc
gtcctgctgcccgaacgcggcgccctccaggtgcagatcgaactgggcgcccccgacggc
gcgggcctgcgcccggtcgcggtgcacacccggcccgcggaggcggacgcaccggacgcc
tggacccggcacgccgagggccgggtcggcccggccggcgccgagcccgcaccggagagc
gccgcttggccgccggccggggccgagccggtcgacctggagggctggtacccgggcctg
cgcgccgacgggtacggctacggcccggtgttccggggcgtgcgcgcggcctggctgctc
ggtgacaccgtccacgccgaggtggagctgcccgagccggcccgccccgacgccccccgc
tacggactgcacccggccctgctggacgcggccctccacccggccgggctcggcccgctg
cgcggccgccccggactgccgttcgcctggaccggcgtcaccctgcacgccgccggggcc
accgcgctgcgggtcacgctcaccccggccggacccgacgcggtccacgtccggatgacc
gacccggccggacggccggtggccaccgtcgacgccctggccgtgcgcccgctcaccgga
gccgccctcgacccggccgcccgggtggcccgcgaggcgctccaccacctggactggccg
gctctgcccgccccgcaggccgctccggccgccgcccgctggaccgtcctcggcgaaccg
cccgcccacgcggccgcgctcgccgaggcggggatcagcttcggccccgggggcggcgtc
gtcctccaccaggccaccggaccgcacccgcgggccgcgctcgaaggcgccctcgccgtg
ctgcgggatcacctcgccgcgggcgcgggcgcgggcgcaggcgcaggcgcaggcgtggac
gcagacggggccggcggcggggacgccaccctgctcgtcgtcacccgccgggccgtcgcc
accgaccccgccgaggacgtccacgacctgcccgccgcggcggtgcacggactggtcggc
tccgcccagaacgagcaccccggccggatcgtgctcgccgacctggacgacgaccccgcc
tcctggcgcaccctgcccgccgccctcgccgcagccctggccgccggcgaaccccggctg
gccctgcgccacggcaccgtccacgccccccggctggtccacgcccacaccgccgcgccg
ctgcccgtccccgacggcccgtggcgcctggacgtccgcaccaagggcacggtcgacaac
ctcgaactgctgccctgcccggacgccgccgaaccgctcgccgacggccaggtgcggatc
gaggtccgggccgcgggcctcaacttccgcgatgtcctcaacgctctcgacatgtacccc
ggcggggcgcggcacctcggctccgaggccgctggcatcgtccgggaggccggaccgggc
gtcaccggactcgccgtcggcgaccgggtgatgggcatggtcccgggcggcttcggcccg
ctcgccgtcaccgaccaccgcctgctcacccggatcccgcaggactggaccttcgcccag
gccgcctccgtccccgtggtcttcctcaccgcctactacgcgctgcgcgacctggccggg
ctccgggccggcgaacgcctgctcgtccatgccgccaccggcggcgtcggcatggccgcc
gtccagctcgcccggctctggggcgccgaggtgtacggcaccgcgagcgaggccaagcag
cacctgctgcgcgccgacggcctgcccggcaccgccatcgcctcctcccgcaccctcgac
ttcgaggagcgcttccgcaccgccaccggcggcgcgggcgtggacgtggtgctcaactcc
ctcgcgggggagtacgtcgacgcctcgctgcggctgctcgcccccggcggccggctgatc
gagatgggcaagacggacgtccgcgacgccgaggaggtcgccgcggcccacggcggcgcc
cgctaccgggccttcgacctccaggaggccggcccggagcggatcgggcagatgctcgcc
gatctggtggagctgttcgaacagggcgcgctgcgacccctcccgctcacctgctgggac
gtcacccgcgcccgggaggccttccggcacatggcccaggcccggcacaccggcaagatc
gtgctcaccgtgccgcgcccctgggaccgggagggcaccgtactgatcaccgggggcacc
ggcaccctcggcggcgaactcgcccgccacctggtcaccgaacacggcgtgcggcacctg
ctgctggccggtcgccgcggcctccaggcccccggagcgcgggagttgagcgaggagctg
gccgcctcgggcgccgaggtcacggtcgccgcctgcgacacctccgaccgcgccgccgtg
gccgccctgctggccggggtgcccgcccggcacccgctgaccgccgtcgtgcacgccgcc
ggcatcctcgacgacggcgtggtcgacgccctcacccccgaacggctcgccgtcgtgctg
cggcccaaggccgacgccgcccaccacctgcacgacctcacccgcggcctcgacctcgcc
gacttcgtcctgttctcctccgccgccggtgtgttcggctcgcccggccagggcggctac
gccgccgcgaacagctggctggacgccctcgcccagcaccgccgggtctgcggcctgccc
gccacctccctggcctggggactgtgggcccaggccagcacgatgaccgcccacctcggc
gcgaccgaccgcgcccgcgccgaacagtccggcgcgctcaccctcgacaccgccgacggc
ctcgccctgttcgacgccgccctcgccgcccgccgcgccctgctggtccccgtccggctg
gacaccgtcgccctgcgcggccgcggcccggccgaactcccgccgctgctgcgcgacctg
gtccgcacccgggcacgccgcacggcgcagtccgggcctgccgcaggcggactgcccgcc
cgcctggcggccctcggcccggccgagcgccacgcggcgctgctcgacctggtgagcggc
tgcaccgcggccgtcctcggccacggttcggccgaacaggtccacgccacccggccgttc
cgcgacctcggcctggactcgctgaccgccgtcgaactgcgcaaccggctcaacaccgcc
accggcctgcggctgcccgccaccctggtcttcgaccaccccacccccggcgcgctcgcc
gggcacctggccgagggcctcggcggccggaccgccggccccgcggccggcaccgcgccg
ggcgccgccgacgaaccggtcgcgatcgtcggcatggcctgccgcttccccggcgccgtc
acctcccccgaggagctgtggaccttgctggccggcggcaccgacgccgtcgccggcttc
cccacggaccgcggctgggacctcgaacggctctacgacggcatccccgaccacccggac
tcctcccgcacccgccagggcggcttcctcgacgccgccgcctggttcgacgccgacttc
ttcggcgtcagccccaacgaggcgctggccatggacccgcagcagcggctgctgctggag
accgcgtgggaggcggtcgaacgggccggcatcgaccccggcaccctgcgcggcagccgc
accggagtgttcgccggcctgtcctccagcgactacctcgaccgggtcgcccgcatcccc
gaggaggccgccccgtacgtcaacaccggcaacgccgtcagtgtcgcctccggccgggtc
gcctacacgctcgggctggagggcccggcggtgacggtggacaccgcctgctcctcctcc
ctggtggcgctgcacctggccgtgcgcgcgctgcgcggcggcgagtgctcgctggccctg
gccggcggcgtcaccgtgatgtccacgccgatgatcccggtcgacttcgcccggcagcgc
ggcctggccgcggacggccgctgcaagcccttcgccgaggcggccgacggcaccggattc
tccgagggcgtcggcgtgctgctggtcgagcggctctcggacgcccggcgcaacgggcac
ccggtgctggcggtggtgcgcggcagcgcggtcaaccaggacggcgccagcaacggactc
agcgcccccaacgggccctcccagcagcgggtgatccgggcggccctggccgacgccggg
ctgtcgcccgccgaggtggacgcggtcgaggcgcacggcaccgggacccggctgggcgac
ccgatcgaggcccaggcgctgctcgccgtctacgggcaggagcgtgaactcccgctgctg
ctgggctcggtgaagtccaacctgggccacacccaggccgccgccggggtcgccggggtg
atccggacggtgctcgcgctgcggcacggcgaactgccgaagtcgctgcacatcgacacg
ccgaccagccacgtggactggtcccaaggggccgtggaactgctcaccgaggcccgcgcc
tggccggagaccggccggccccgccgggccggcgtctcctccttcggactcagcggcacc
aacgcccatgtgctcctcgaagcggcatccgaatccgaaggcgtccagcccggtgccgtt
gagcccggtgccgttgagcccggtgccgtgccggccggcgccccggaacccggtgccccc
gaatccggcgccctgccctggctgctctccgcccgcagcgcccaggcgctgcgcggccag
gcccgcgccctgctcggccacctcgacgccgccgccccggcgcccctcgacctcgcccac
tcgctcgccacccgacgcgccctcctggagcaccgggccgccgtcatcggcaccggcccc
gaggagctgcgcgccggcctgaccgccctcgccgacggcgcccccgcccccggcgtggtc
accggccggcacgccgccgggcgggaccgcagggtcgtcctgctgttccccggccagggc
tcccagtgggccggcatgggcgccgaactcctcgacagctcaacggagttcgccgagacc
atcgccgcctgcgaacaggccctggcgccctggacggactggtcgctgagcgccgtcctg
cgcggcgcgccggacgccccggcactggaccgggtcgacgtcgcccaacccgcgctctgg
gccaccatgatcgcgctcgccacctgctggcaggcccacggggtgacccccgccgccgtc
ctcggccactcccagggcgagatcgccgccgcctgcgtggccggcgcgctctccctggag
gacggggccaaggtggtcgccctgcgcagcctggccatcgcccgcgcactgtccggccac
ggcggcatggtgtccgtcccgcagacccacgccgaggtcctggcccggatcgaaccctac
gacggccggatctcggtcgccgccgccaacggccccgccggggtggtggtctccggcgag
cccgaggccctcgaccggctgctggccggctgcgagcacgacggcgtccgggccaagcgg
atccccgtcgactacgcctcgcactccgcccaggtcgagcgcatcgagcggaccctgctc
accgaactccacgggatcaccacccgggaggcccggatcccgttcttctccaccgtcacc
gccgactggctcggcgacaccccgctggacgcccggtactggtaccggaacctgcgccgc
accgtccggctggaggagtccgtccgcgccctgctcgcccagggccacgacgccttcctc
gaatgcagcccccacccggtgctggccatggccgtcgaggacaccgccgccgacgccggg
gcccgggccgtggtgctgggcaccgtccggcgtgaggacggcggccccgcgcggctgctg
acctcgctcgccgaggcgcacgtcagcggggtgcggatcgactgggcccccgccctggcc
ggcggacgcccggtggacctgccgacctacgccttccagcgtcgccgctactggctcgcc
cgggacaccgccgccgccggcacgaccgacccgtccggactggaccgcgccgtccacctc
gcgggcggtgacacggtcctgctcaccggccggatcggcaccgccacccacccctggacc
gccgaccaccaggtgcgcggcaccgccgtcgttcccggcaccgccctgctcgactgggcc
gtccgggccggcgacgaggccggctgcccggctgtcgccgaactcaccgagcacagcccg
ctggtcctgcccgagcacggcaccctcgacctccagctcaccgtcggcccggccggcgag
gacggccggcggcccctcaccgtccacgcccgccgcaccgacgcacccgggtccaccccg
tggacccggcacgccgccggcaccctcgcccccgccggggcgccgtccgccgcccggccg
gcgtcccacgacgccctgccgccggacaccggcacccccaccgacacccacgccggaccg
gacgggtacggcgagcgcttccgcaccgtccggtcgctcgtccggcgaggcgaggagcgg
tacgccgaggtcgccctggccgaggagcaccgggccgaggcggccggcttccggctccac
cccgcgctgctccagggcctgctcgccgccaccggggccggcgcggacgccggcgccgcc
gcccagcccgccgactggcgcggggtcaccctgcacgccaccggcgccacccggctccgg
gtccggctcaccccgggccccgacggcagccacgcgctcagcgccgtcgacccggacggc
gcccccgtgctcaccgtcgaggccgtcaccgcccgcccgatcgccgccgaccggctcggg
cccgagcccgagccgctgtacgcggtcgagtggtgcccggtgacccccggcgaaccgcgc
gggaccctcgccctcctgggcgcggacccggcagccacggacccgtcggtctcggtcccg
tcggccacggatcccggtccggccgccgcgcccggtgcccccggctacgccgacctggcc
gagctcaccgccgccctggacgccggcgagccggcccccgacaccgtcgtccaccgtctc
accaccgccgacggcgacgaccccgtcaccgccacccaccaggccgtccgggccgcccac
cgcctcgcccgcgcctggctcgccgaaccgcgcctggccggctcccggctcgccctgctc
acccggggcgccgaagccgccgcccccggagaggacgtgacctccctcgcccaggccgcc
gtgcacggactgatccgctccgcgcagtccgaggagcccggccggttcctgctgctcgac
ctcgacgacgacccggcgtccgcggcggccctgtccgccgccctcgccgtgcccgacgag
ccccggctcgccgtccggcacggccgggtgacggccccccggctgcgcccgctgccggtc
cccgggcccgggcagacgtccacggaccgtccggcctggtcctggaaccccgccggcacc
gtcctgatcaccggcggcaccggtaccctcggcgcactggtcgcccgccacctgatcacc
gcacacggcgtgcgccacctgctgctcaccggccggcgcggccccgccgcccccggcgcg
gaggccctgcgcgatgagctcaccgccctcggtgccaccgtcaccgtcgccgcctgcgac
accgcggaccgggccgccctggacgccctgctcgccaccgtcccggccgagcacccgctc
accggggtcgtgcacgccgccggcgtcctgcacgacgggctcctcgccaacctgacggac
gagcagctcaccgaggtgctgcgccccaaggccgacgccgcctggcacctgcaccgcgcc
accgcgcacctggacctctccgccttcgtcctcttctcctccttcgccgccaccgcaggc
ggaccggcccaggccaactacgcggccgccaacgccttcctcgacgcgctggcgcaccgg
cgccgggcggagagccgcccggccgtctcgctcggctggggatactggggagaatcgagt
gcgatgacgtccacgctggacgccgtggacatcgcccgcttcgcccgctccggcatgctg
ccgctcccggccgcccagggcctcgccctgctcgacgccgcgagcaccgtggaccgcccg
cacctcgcccccgtacggctcgaccggcacgccctggccacggctggcgctccgccgctc
ttcgccgacctgctgccccggcgcgccaccgcgcggcccacggccgccggcaccgccacc
ggcggcgatcggggagtcccggaccggctggccggcctcggcgccgcccagcaggagcag
ctgctccagagcctggtgatcggccacctggcggccgtgctcggtcacgcggagcccgac
gcgctcgaaccggaacgcggcttcctggaccacggcatgtcctcgctggccgccgtcgaa
ctgcgtaaccggctgaacgccgagctcggactgcgcctgcccaccaccacggtcttcgac
cacccgtcaccggtcgccctggccggccggctgcgcgaactcctgggcgcgccgacggac
gccgcggccccggcccggcccgtcttcgccgaactggacgtcctggagaccgcgctcacc
ggcgcgctcgacagcgccgccctggacccggcgtcccgcgcccggctgctcacccgcctc
aagagcctccagtggcggctcgacgacggcgcgacggagccggccgacggcgactccgaa
ccggacgccggactcgacggcagcaccgacgacgagatgttcgacctgatcgaccgcgag
ctcggactcgcctga

DBGET integrated database retrieval system