KEGG   Kitasatospora aureofaciens: B6264_27185Help
Entry
B6264_27185       CDS       T05021                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00564  Glycerophospholipid metabolism
kau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B6264_27185
Enzymes [BR:kau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B6264_27185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_binding_3 GIDA 3HCDH_N AlaDh_PNT_C Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ARF82072
UniProt: A0A1E7MXS1
LinkDB All DBs
Position
complement(6204419..6206011)
Genome map
AA seq 530 aa AA seqDB search
MATIPTLGAERTAGRTASRAETRELLGKATYDLLVIGGGILGTAVAWTASQAGLKVAMVD
AGDFAGATSSASSKLVHGGLRYLQTGAVKLVAENHKERRALSTDVAPHLVNPLTFFVPVY
KGGPHGAAKLGAGVFLYSALSAFRDGMGRVSTAAHAAQQVPALRTEGLRSVAVYGDHQMN
DSRVAVMTVRAAVDAGAVVLNHAEVTGLRFTGGRVTGAELRDRLDGSEFGVNARLVLNAT
GPWVDHLRKMEDAGAAPSIRLSKGAHVVVKRRSPWRAALTIPIDKYRVSFAIPWEDHVLL
GTTDEEYTGDPKDVRATDADIDQIMGEAAHAIRDEHLDRDLITYSFAGLRVLPGGPGDTA
AAKRETVVTEGRGGMLSVSGGKWTTYRHIGRTVLEKLAHVPGTSLGEDMSPIAPTVPLPG
VGAPNAVAHRLLIDREPGSRMEPLVAKHLASHYGTLSFEIARMIDENPELGRPIHEDGPD
VWAQVAYAAENEWAYTADDVLRRRTTMTVRGLDTPEIRGEVEAFLAKRSK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccatcccgaccctgggcgccgagcgcaccgccggccgcaccgcctcccgcgcc
gagacccgtgagctgctcggcaaggccacctacgacctgctggtgatcgggggcggcatc
ctcggcacggccgtcgcctggaccgcgtcccaggccggcctgaaggtcgccatggtcgac
gccggcgacttcgccggtgccacctccagcgcctcctccaagctcgtccacggcggtctg
cgctacctgcagaccggcgcggtcaagctggtcgcggagaaccacaaggagcgccgcgcg
ctctccaccgacgtggccccgcacctggtcaacccgctgaccttcttcgtgccggtctac
aagggcggcccgcacggcgcggccaagctcggcgccggcgtgttcctgtactcggcgctg
tccgccttccgcgacggcatgggccgggtctccaccgccgcccacgccgcccagcaggtg
cccgcactgcgtaccgagggcctgcgctcggtggccgtctacggcgaccaccagatgaac
gactcgcgcgtcgcggtgatgaccgtgcgcgccgccgtcgacgccggcgccgtggtgctc
aaccacgccgaggtcaccggcctgcgcttcaccggcggccgggtcaccggcgccgagctg
cgcgaccgcctggacggcagcgagttcggcgtgaacgcccgcctggtgctcaacgccacc
ggcccgtgggtggaccacctgcgcaagatggaggacgccggcgccgcgccgtcgatccgc
ctctccaagggcgcccacgtcgtcgtcaagcgccgctcgccgtggcgcgccgcgctgacc
atcccgatcgacaagtaccgcgtctccttcgccatcccgtgggaggaccacgtcctgctc
gggaccaccgacgaggagtacaccggcgacccgaaggacgtccgggccaccgacgccgac
atcgaccagatcatgggcgaggccgcgcacgcgatccgcgacgagcacctcgaccgcgac
ctgatcacctactccttcgccggcctgcgggtgctgcccggcggcccgggcgacaccgcc
gccgccaagcgcgagaccgtcgtcaccgagggccgcggcggcatgctgtcggtctccggc
ggcaagtggaccacctaccggcacatcggccgcaccgtgctggagaagctggcccacgtc
cccggcaccagcctcggcgaggacatgtccccgatcgccccgaccgtcccgctgccgggc
gtcggcgcgccgaacgcggtggcgcaccgcctgctgatcgaccgcgagccgggctcgcgg
atggagccgctggtggccaagcacctggccagccactacggcacgctctccttcgagatc
gcccgcatgatcgacgagaacccggagctcggccggccgatccacgaggacggtccggac
gtctgggcgcaggtcgcctacgcggccgagaacgagtgggcgtacaccgcggacgacgtg
ctgcggcgccgcaccaccatgacggtgcgcgggctggacaccccggagatccggggcgag
gtcgaggccttcctggcgaagcgctccaagtaa

DBGET integrated database retrieval system