KEGG   Kitasatospora aureofaciens: B6264_28005Help
Entry
B6264_28005       CDS       T05021                                 

Definition
(GenBank) ligase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
kau  Kitasatospora aureofaciens
Pathway
kau00550  Peptidoglycan biosynthesis
kau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kau00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B6264_28005
Enzymes [BR:kau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     B6264_28005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M OrfB_Zn_ribbon DZR
Motif
Other DBs
NCBI-ProteinID: ARF82209
UniProt: A0A1E7NCI5
LinkDB All DBs
Position
complement(6386741..6388003)
Genome map
AA seq 420 aa AA seqDB search
MAGTESEPTGARDASLPARAKIAVTAGKVAAAVSRKAGRGSGSVIGGKVALRLDPDLLAT
LADHLDVVLVSATNGKTTTTRLIAEALRAAGPVVSNALGANMPAGITSALAGGTDARFGV
IEVDEKYLATVARDTHPKAIALLNLSRDQLDRAAETRMMAEKWREGLQDTEAVVIANADD
PLVTWAASSCKKVVWVAAGQAWKEDAWSCPACGGVMQRPGDDWFCQECGFRRPNPHWALQ
GTHVIDPQRGAWPIQLQLPGRANLANATSSAAVAAVFGVSPQVALERMRSVSAVAGRYDV
VQYQGRDIRLLLAKNPAGWLETFSLIDGPPAPVLLSVNALDADGTDTSWLWDVDYERLAG
HPIFVMGQRKLDLAVRLEVAGLQFHVVDTLEQAVRMAPPGRIEAIANYTAFQQLRKVVAG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccgaatcggagcccacaggcgcacgcgacgcctcgctgccggcccgcgcc
aagatcgcggtcacggccggcaaggtcgccgccgccgtgtcccgtaaggccggtcgcgga
agcggctcggtgatcggcggcaaggtcgccctcaggctcgaccccgatctgctcgccacc
ctcgccgaccacctcgacgtcgtcctggtcagcgccaccaacggcaagaccaccaccacc
cgcctgatcgccgaggcgctgcgcgccgccggcccggtggtctccaacgccctgggcgcc
aacatgccggccggcatcacctccgcgctggccggtggcacggacgcccgcttcggcgtg
atcgaggtcgacgagaagtacctggcgacggtcgcgcgcgacacccaccccaaggcgatc
gccctgctcaacctctcccgcgaccagctcgaccgcgccgccgagacccgcatgatggcg
gagaagtggcgcgagggcctgcaggacaccgaggccgtggtcatcgccaacgccgacgac
ccgctggtgacctgggccgcctcctcctgcaagaaggtcgtctgggtggccgccggacag
gcctggaaggaggacgcctggtcctgccccgcctgcggcggtgtgatgcagcgcccgggc
gacgactggttctgccaggagtgcggcttccggcgccccaacccgcactgggcgctccag
ggcacccacgtgatcgacccgcagcgcggcgcctggccgatccagctgcagctgcccggc
cgggccaacctggccaacgccaccagctcggccgccgtcgccgccgtgttcggcgtctcc
ccacaggtcgcgctggagcggatgcgctcggtgagcgcggtggccggccgctacgacgtg
gtccagtaccagggccgggacatccgactgctgctcgcgaagaacccggccggctggctg
gagaccttctcgctgatcgacggcccgccggcgccggtcctgctctcggtcaacgccctc
gacgccgacggcaccgacacctcctggctgtgggacgtcgactacgagcgcctcgccggg
cacccgatcttcgtgatgggccagcgcaagctggacctggccgtccgcctggaggtcgcc
gggctgcagttccacgtggtggacaccctggaacaggccgtccggatggccccgcccggc
cggatcgaggcgatcgccaactacaccgccttccagcagctgcggaaggtcgtggccggc
tga

DBGET integrated database retrieval system