KEGG   Kozakia baliensis: A0U89_04780Help
Entry
A0U89_04780       CDS       T04547                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
kba  Kozakia baliensis
Pathway
kba00020  Citrate cycle (TCA cycle)
kba00190  Oxidative phosphorylation
kba00650  Butanoate metabolism
kba01100  Metabolic pathways
kba01110  Biosynthesis of secondary metabolites
kba01120  Microbial metabolism in diverse environments
kba01130  Biosynthesis of antibiotics
kba01200  Carbon metabolism
Module
kba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kba_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A0U89_04780
   00650 Butanoate metabolism
    A0U89_04780
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A0U89_04780
Enzymes [BR:kba01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A0U89_04780
    1.3.5.4  fumarate reductase (quinol)
     A0U89_04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AOX16553
UniProt: A0A1D8USE3
LinkDB All DBs
Position
1048401..1049180
Genome map
AA seq 259 aa AA seqDB search
MVEIRLPANSRTREGKTYPAPQNAVNTREFKVYRWSPDDEENPTIDTYVLDLDKVGPMVL
DALLYIKDHVDETLTFRRSCREGICGSCAMNIDGENTLACLKPIDSIKDEVKISPLPHMP
VVKDLVSNLNGAYAQLNAIQPWLKSDTPPPPDEERRQSIEEREKLDGMWECILCFCCTTS
CPSYWWNGDKYLGPATLLAANRWIVDSRDDHTAERLDALQDPMSLYACRTIMNCTQTCPK
GLNPAKAIANIKKMQIDRG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaattcgcctgcccgccaatagcagaacccgcgaaggaaaaacctatcccgcg
ccacaaaacgcggtgaatacacgcgagttcaaggtctatcgttggtcgcctgacgacgag
gaaaatcctacgatcgatacctatgtgctcgacctggacaaggtcggccccatggttctg
gatgcgctgctttacatcaaagatcatgtggacgagacgctgaccttccgcagatcatgc
cgtgaaggtatttgcggttcatgcgctatgaatatcgatggcgagaacacgttggcgtgt
ctcaagccgattgacagcatcaaggatgaggtgaagatcagccccctaccgcatatgcca
gtggtgaaggatctggtttcgaacctgaacggcgcttacgctcaactcaacgccattcag
ccctggttgaagtcggatacgccgccgccgcccgatgaagagcgccgccagagcattgaa
gaacgtgaaaagctcgatggcatgtgggagtgcattctgtgcttctgctgcacgacctct
tgtccgtcctattggtggaatggcgataaatatcttggcccggcgacgcttcttgccgca
aatcgctggatcgtcgatagccgtgacgatcataccgcggaacgcttggatgcgttgcag
gacccgatgagcctttacgcttgtcgtacgatcatgaactgcacgcagacatgtccgaaa
ggcctcaatcctgccaaggcgattgccaacatcaagaaaatgcagattgaccgaggataa

DBGET integrated database retrieval system