KEGG   Kozakia baliensis: A0U89_10155Help
Entry
A0U89_10155       CDS       T04547                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kba  Kozakia baliensis
Brite
KEGG Orthology (KO) [BR:kba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A0U89_10155
Enzymes [BR:kba01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A0U89_10155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 AlaDh_PNT_C FAD_binding_3 K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AOX17442
UniProt: A0A1D8UUW7
LinkDB All DBs
Position
complement(2180724..2182304)
Genome map
AA seq 526 aa AA seqDB search
MLQDNIKTQLKGYLANLAHPIVLEASLDHSPKGREMHELLHEVAALSDKVHVSETGEATR
RPSFEIKREGAKHGVAFAAIPMGHEFTSFILAMLQVGGHAPKFSDDLIAQIKALPGQYTF
ETFVSLSCQNCPEVVQALNAMSVINPNIRNVTIDGGLFQDEVAEKNIMSVPQVYLNGESF
GSGRMDAEQILAKLDADAPKRAAAKLKDVPPFDVLIIGGGPAGASAAIYSARKGLRTGIV
ADRFGGQVMDTAGIENFISIKETEGPKLSAALEAHVRQYDVDVISSQRVKELFPASRPGG
LHGVALESGPILHARTIIIATGAHWRQLGVPGEEEYRNKGVAYCPHCDGPFYKGKRVAVA
GGGNSGVEAAIDLAGIVSHVTLLQRGSRLKADKVLQDKLLSLPNVTVLMEALTTRIQGNG
KNVTGLTYRGGDGADHHIDLEGVFVQIGLLPNTDWLRGTLKLSDYGEIVVNDHGATSVPG
IFAAGDATTTPYKQIVIAVGDGAKASLSAFDYLIRVPVTDEKRVAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggacaacatcaaaacgcaacttaaaggctatctggcgaatctggcccacccg
atcgtattggaagcctcgctcgaccacagccccaaagggcgcgagatgcatgaacttctg
catgaggtcgccgctctttccgataaggtgcatgtctccgagaccggggaagccacccgt
cgcccttccttcgaaatcaagcgtgaaggcgccaagcatggcgtggcgttcgcggcgatt
ccgatggggcatgaattcacctccttcatcctggcgatgttgcaggtgggcggccatgcg
ccgaaattctccgacgatctgatcgcgcagatcaaggcgctgccggggcaatacacgttc
gaaactttcgtttcgctctcctgccagaactgtcctgaagtggtgcaggcgttgaacgcg
atgagcgtgatcaaccccaatatccgcaacgtgaccatcgacggcgggctgtttcaggac
gaagtggccgaaaagaacatcatgagcgtcccgcaggtctatctaaacggggagtcgttc
gggtctggccggatggatgccgagcagatcttggcgaagctggatgcggatgcacccaag
cgtgcggcggcgaagctcaaggatgtgccgcctttcgatgtactgatcatcggcggcggc
ccggcgggcgcttcggcggcgatctattcggcgcgcaaaggtctgcgcaccggcatcgtg
gccgaccgctttggcggtcaggtaatggacacggcggggatcgagaacttcatctccatc
aaggagacggaagggccgaagctttccgcggcgctggaagcgcatgtgcggcaatatgat
gtggatgtgatttcgtctcagcgtgtgaaggaattattccctgcctcgcgcccaggcggg
ttgcatggcgtggcgctggaaagcggaccgatcctgcatgcgcgcaccattatcatcgcc
acgggcgcgcattggcggcagttgggcgtgccgggcgaggaggaataccgcaacaagggc
gtggcttactgcccgcattgcgatggcccgttctacaagggcaagcgcgtcgcggtcgcg
gggggcggcaatagcggcgtggaagcggcgatcgatctggccgggatcgtctcgcatgtg
acgttgttgcagcgcggctcgcgcctgaaggccgataaggtgttgcaggacaagctgttg
agcctaccgaatgtgacggtgctgatggaagccctgaccacgcgcatccagggtaacggc
aagaacgtgactgggctgacttatcgaggcggcgatggggcggaccatcatatcgatctg
gaaggcgtgttcgttcagatcggcttgttgccgaacacggattggctgcgcggcacgttg
aagctgagcgattacggggagatcgtcgtgaacgaccatggcgcgacttctgtgccgggc
attttcgcagcaggcgatgcgacgacgacgccttataagcagatcgtcatcgccgtaggc
gatggggcgaaggcttcgctttccgcgttcgattatctgatccgcgtgccggtgacggac
gaaaagcgcgtggcggcctaa

DBGET integrated database retrieval system