KEGG   Ktedonobacterales bacterium SCAWS-G2: EPA93_24290Help
Entry
EPA93_24290       CDS       T05969                                 

Definition
(GenBank) ribonucleotide-diphosphate reductase subunit beta
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
kbs  Ktedonobacterales bacterium SCAWS-G2
Pathway
kbs00230  Purine metabolism
kbs00240  Pyrimidine metabolism
kbs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kbs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EPA93_24290
   00240 Pyrimidine metabolism
    EPA93_24290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kbs03400]
    EPA93_24290
Enzymes [BR:kbs01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     EPA93_24290
DNA repair and recombination proteins [BR:kbs03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    EPA93_24290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm
Motif
Other DBs
NCBI-ProteinID: QBD78933
UniProt: A0A4P6JUD0
LinkDB All DBs
Position
complement(5586560..5587594)
Genome map
AA seq 344 aa AA seqDB search
MNLEFEEAQTPGAQKRLINGSSVDVNQLMPLKYKWAWEHYLNGCANHWMPTEVPMARDIE
IWRSSTLSANERLVIMRNLGFFATAESLVGNNLVLSIFKQITNAECRQYLLRQAFEEAVH
THAFLYIVESLGLNEREVFGMYHDIPAIARKDDFEMKLTSALLDPNFSTETPEGIQTFLK
NLIGYYVIMEGIFFYSGFVMMLSFHRRNLMTGVGEQFQYILRDETIHLNFGIDLINGIKA
ENPDVWTPTFKQHISELIKEAVELEIAYAQDCLPQGILGLNAEAFRHYVQHIADRRLERI
GLPALYHASHPFPWMSETMDLSKEKNFFETRVTEYKSAATLQWD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttgaatttgaagaagcgcagacgccgggggcacaaaagagactcatcaacggc
tcgtcggtcgatgtcaatcagctaatgcccttaaagtataaatgggcctgggagcactat
ctcaatggctgcgccaatcattggatgcccaccgaagtgccaatggccagggatatcgag
atctggcgttcaagcacgctaagcgccaatgagcgcctggtcatcatgcgcaaccttggc
ttttttgccaccgctgagagcctggtgggcaacaaccttgtgctctccatctttaagcag
ataaccaatgccgagtgccgtcagtatctgctacgccaggcctttgaggaggccgtgcat
acgcacgccttcctctacatcgttgagagcctggggctcaatgagcgcgaagtctttggg
atgtaccacgatatccccgccattgcgcgcaaagacgactttgagatgaagctcacctca
gctctgcttgatcccaacttttccacggagacccccgagggaattcagaccttcctcaaa
aatctgatcggctactacgtcatcatggaaggcatctttttctatagcggctttgtgatg
atgctctccttccatcgacgcaacctcatgaccggtgttggtgagcaattccagtatatc
ttgcgcgacgagaccattcatctgaactttggtattgatctgatcaatgggatcaaggcc
gagaatccagatgtttggacgccaactttcaagcagcatatcagcgagctgatcaaggaa
gctgtagagctggagattgcctatgctcaagattgcttgccgcagggaatattgggcttg
aacgccgaggcctttcgccactacgttcagcatattgccgaccggcgcctggagcgcatc
ggcttgcccgcactctaccatgcttcccatcccttcccctggatgagcgagaccatggac
ctgagcaaagaaaagaacttctttgagacccgtgtcaccgagtataaatcggccgcgacc
ctgcaatgggactag

DBGET integrated database retrieval system