KEGG   Ktedonobacterales bacterium SCAWS-G2: EPA93_40635Help
Entry
EPA93_40635       CDS       T05969                                 

Definition
(GenBank) biotin--[acetyl-CoA-carboxylase] ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
kbs  Ktedonobacterales bacterium SCAWS-G2
Pathway
kbs00780  Biotin metabolism
kbs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kbs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EPA93_40635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kbs03000]
    EPA93_40635
Enzymes [BR:kbs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     EPA93_40635
Transcription factors [BR:kbs03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    EPA93_40635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C TagF_N
Motif
Other DBs
NCBI-ProteinID: QBD81952
UniProt: A0A4P6K238
LinkDB All DBs
Position
complement(9442861..9443724)
Genome map
AA seq 287 aa AA seqDB search
MKKIESTAFKQLDVEAIQRQLDTRFFGIGNHLVFLSTVDSTNVLAMQLAQDGSEEGVVVL
TDSQTAGKGRLGRHWVDQPGHSVISSTILRPFFPPYHLIMFASLAVVDAIADTCGVAATI
KWPNDVLVGDRKVAGILIETSRDRSGRGFAIVGIGVNVNGDFTEAIPSQAVPGLTQAATT
LQSACGHRVSREFFITRLLQHMESSYLLLQQEAQDPLAQAYGSSSRLIRERWRNQLSTLG
RTIQVRQGDSMLSGIAEDVDEHGELLLRCHSGDRVSITWGDIGYPTQ
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagatagaaagtaccgcgttcaagcagctcgatgtagaggcaatacagcgtcag
ctcgacactcgtttctttggcatcggaaatcatcttgtatttttatcaacagtggactca
actaatgtgttggcgatgcaactggctcaggatgggtcagaggagggggttgtggtactt
accgacagtcaaactgcaggcaaaggccgcttaggcagacattgggtagatcaacctgga
cacagcgtgatttcatctaccatactgcgaccatttttcccaccctatcacttaatcatg
tttgcttcgcttgctgtagttgacgccattgccgacacttgtggagttgcagcaaccatc
aaatggcccaacgatgttctcgttggggaccgcaaagtcgccggtatcttgattgaaacc
agccgtgaccgttccggtcggggcttcgctatcgttggaataggcgtcaatgtaaacggt
gattttacagaagctattccgtcacaggccgtgccgggacttacgcaggcagccacaacg
ctgcaaagcgcttgcggtcatagagtaagccgtgagttttttatcacgcgcttgctgcaa
cacatggagtcaagctatctcttgttgcagcaagaagcgcaagacccactagcgcaagcc
tacgggtctagctctcggttgatacgagagcgctggcgcaatcagctatcaacgcttggt
cgtaccattcaggtacgccagggagattccatgctcagcggtatcgctgaagatgtggat
gaacacggagagctgttactccgctgtcattcaggtgatcgagtcagtattacctggggc
gatattggataccccacacaataa

DBGET integrated database retrieval system