KEGG   Candidatus Kinetoplastibacterium blastocrithidii TCC012E: BCUE_0296Help
Entry
BCUE_0296         CDS       T02463                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kbt  Candidatus Kinetoplastibacterium blastocrithidii TCC012E
Pathway
kbt00620  Pyruvate metabolism
kbt00680  Methane metabolism
kbt01100  Metabolic pathways
kbt01120  Microbial metabolism in diverse environments
kbt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kbt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCUE_0296
  Energy metabolism
   00680 Methane metabolism
    BCUE_0296
Enzymes [BR:kbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BCUE_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF5347
Motif
Other DBs
NCBI-ProteinID: AGF49526
UniProt: M1LZN2
LinkDB All DBs
Position
complement(77219..80032)
Genome map
AA seq 937 aa AA seqDB search
MQISTLRQEIRLLGKMLGETIYSCEGKRLFDIIESIRRSAIRLRQNSKDPDDESLEVYIS
KLENNDPNTVARAFSYFMHLVNIAEDNDQNRRHKAHLSELDYPIRGSLKDVISKLQYNGV
TTHEISELLNESCMSPVLTAHPTEIQRKSTLDAHRNISRKLIERNNRSNKEDLKEIDLEL
LGHIAILWQTRILRYSSLTVTDEIENALSYYRSTFLPTIPKLYRDLSNLLNTSENCTSMP
LKPFLRMGSWIGGDRDGNPNVDELTLEQAMARQSSVILEHYLKEVFALKTELSLSNLLVE
VDEDLLSLAEKSNDMSPHLKDEPYRKALIGIYARLAATSEKLAGKNLARRVILPALPYKS
SEEFYKDLNTISSSLEKHHGDLINSLRLKNLQQSVKVFGFHLTTLDLRQNSDVHERVLTE
LFLQANITLDDKKNRYSDLNEEDKVKILRFELMQGRQLVSPWFEYSAETTKELKIFRAAA
KIRKDYGEAAILQSIVSHTETLSDLLEVLVLQKETGLIKPTYYPHKEHEGLMVVPLFETI
TDLQNSSDIMSKWMDLPEVNSIIRNSHNNTQEVMLGYSDSNKDGGFLTSNWELYQAERNL
VNVFRSRNIRLRLFHGRGGSVGRGGGPSFEAILSQPPGAVSGQIRLTEQGEIVHGKYNNA
EVGKWHLELLVAATLESSLSPRSNKKNVDSTYLDKYGEAMSFMSSYAENIYRNLVYEKPG
FTEYFFTSTPINEIAELNIGSRPSSRKNLQNIEDLRAIPWSFSWSQCRLMLTSWYGVGSA
IEHFIENGTSVISKSKNDRLELLRIMIKEWPAFKTLVSNMEMVLIKSDLSIASCYSKLVP
NQTLRNNVFNAISLEHRKTIGMLRLLTKRDLLEDNPTLLNALKERFTYIDPLNYLQVELL
RRHRYGHSSISQSSKEMIKRDIHITINGIAAGLRNSG
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatatcaactctacgtcaagaaattcgtttattaggaaagatgctaggagaaaca
atctatagctgtgaaggaaaacgtttatttgacataatagaatcaattagacgatctgct
ataagacttcgacaaaatagtaaagatcctgatgatgaatcattagaagtctatattagc
aagttagaaaataatgatcctaacacagtagcaagagcatttagctatttcatgcatcta
gttaatatcgccgaagataatgatcaaaaccgtagacataaagcacatctttcagagctc
gactacccaatacgaggcagcttaaaagatgtaattagtaaactgcaatataatggtgtt
accacacatgagattagtgaattattaaatgagtcttgtatgtctccagtgctaacagcc
catccaacagaaatacaaaggaaaagcacattagatgcccacagaaatatttcaagaaag
cttatagaaagaaataatagatctaataaagaagatttaaaagaaattgacttagagcta
ttaggacacatcgcaatactatggcaaacaagaatactgcgatattctagtcttacagta
accgatgagatagaaaatgctctatcatattatcgtagtacattcttgccaacaattcca
aaattatacagagatctttctaatttactaaatactagtgaaaattgtactagtatgccg
ttaaagccttttctaaggatgggtagctggattggcggagatcgtgatggcaatccaaat
gtagatgaattaactctagaacaagctatggctaggcagtcttctgttatattggaacac
tacttaaaagaagtatttgcattaaaaactgaattatctcttagcaacctattagtagaa
gtagatgaagatctgttatcactagcagaaaagagcaatgacatgtctcctcatttgaaa
gatgagccttatagaaaagcattgataggtatatatgctaggttagcggcgacatcagag
aaactagctggaaaaaatcttgctagaagagtaatcctccctgctctaccttataaatca
tctgaagagttctacaaagacttaaatacaatatctagctccctagaaaaacatcatgga
gatttaataaactcactaagattaaaaaatttacagcaatctgtaaaagtcttcggattc
catctaactacattagatttaaggcaaaactcagatgttcatgaaagagtactaactgaa
ctctttctacaggcaaatataactctagatgataaaaaaaataggtattctgatttgaat
gaagaagataaagtgaaaattcttagatttgaattaatgcaaggccgacaactagtatcg
ccatggtttgaatatagcgcagaaactactaaagagctgaagatttttagagcggccgct
aaaattagaaaagattacggagaagccgcaatattacaatctatagtttcacatacagaa
acattaagcgatcttctggaagttctagttctacaaaaagaaactggactgataaagcca
acatactatcctcataaggagcatgaaggactgatggtagtgcctttgtttgaaacaata
actgatcttcaaaatagttcagatattatgtctaaatggatggatctaccggaagttaat
tctattattagaaactcacataataatactcaagaagttatgcttggatattccgatagc
aataaagatggcggttttttaacttctaattgggaactttaccaagcagaaagaaaccta
gtaaacgtatttagatctagaaatattaggctaagactattccatggaagaggaggctct
gttggtaggggcggaggtccaagttttgaagcaatactatctcaaccacctggagcagta
tcaggacaaataagacttactgaacaaggagagatagttcatggcaaatataacaatgca
gaagtaggtaagtggcatcttgaactattagtagcggcaacccttgagtctagtttaagt
cctagatcaaataagaaaaatgtggatagtacttatctagataagtacggagaagcaatg
tcatttatgtctagttatgcagaaaacatatatcgcaatttagtctatgagaaaccagga
ttcacagaatattttttcacatctacaccaattaatgaaatagcggaattaaatatagga
tctagaccatcatcacgcaaaaacctccaaaatattgaagatttgcgagctataccctgg
agcttctcttggtctcaatgccggttaatgctaacgagttggtatggcgtgggatctgca
attgaacattttatagaaaatgggactagcgtaatttcaaaatccaaaaatgatagatta
gaattattaagaataatgataaaagaatggccagcttttaaaaccttggtatcaaatatg
gaaatggtcctcataaaatctgatctcagtattgcttcttgttactcaaaattagtgcct
aatcaaacactaagaaataatgtgtttaatgcaataagcttggaacaccgtaaaaccata
ggaatgctaagattactaactaaaagagatcttctagaggataaccctacgttactaaat
gccttaaaagagcgttttacatacatagatccactaaattacctccaggttgaacttctt
cgtagacatcgttatggtcatagttcaatatctcaaagctctaaagaaatgataaaaaga
gatatacatataactattaacggaattgctgctggacttagaaattccggttga

DBGET integrated database retrieval system