KEGG   Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255): CKCE_0043Help
Entry
CKCE_0043         CDS       T02413                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kci  Candidatus Kinetoplastibacterium crithidii (ex Angomonas deanei ATCC 30255)
Pathway
kci00550  Peptidoglycan biosynthesis
kci01100  Metabolic pathways
kci01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CKCE_0043
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CKCE_0043
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CKCE_0043
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kci01011]
    CKCE_0043
Enzymes [BR:kci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CKCE_0043
Peptidoglycan biosynthesis and degradation proteins [BR:kci01011]
 Precursor biosynthesis
  Amino acid ligase
   CKCE_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_ST ATP-grasp_4 TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AFZ82488
LinkDB All DBs
Position
56556..57488
Genome map
AA seq 310 aa AA seqDB search
MTISFGKVGVLYGGQSSEREVSLISGKNIFNALKSKGLDVHLFDTGINSLADLIEAKFSV
VFIALHGRFGEDGVIQGILDLLGIPYTGSGQLSSSISINKIITKKLWKYEGLLTPDFMSL
SGKKDFSNACDFLGLPLIVKPVGEGSTVGTTVVKLYDDMDKAYINASVFNNEVFAEKLIV
GRELTVSIIENSSGINVLPIIEIITPDNRCYDYESKYFSKETKYLCPAKLPLELNNDLIK
ICKKAYEVIHCKGWARIDIILDKFNKAWLLEINTCPGMTINSLMPIAARANGINYEDLCL
SILSMASFKK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgactatatcttttggcaaggttggagtgctgtatggaggccaatcctctgaaagagag
gtgtctttgatctcagggaaaaatatattcaatgcgttgaagagtaaggggttggatgtt
catttgtttgatacgggaattaacagtctagctgatttgatagaagcaaaattttctgtc
gtttttattgcattacatggtagatttggagaagatggtgttattcagggtattctagac
ctattaggtattccatatactggaagtggtcaattatcatctagtatatcaatcaataaa
ataattactaaaaaactatggaaatatgaaggattgttaactcctgattttatgtcctta
tctggaaaaaaagattttagtaatgcatgtgattttttaggattgcctttaattgttaag
cctgttggagagggttctaccgtaggaacaacagtagtaaagctgtatgatgatatggat
aaagcatatataaatgcatcagtttttaataatgaagtttttgctgaaaaattgattgtt
ggtcgagaactgactgtttctattattgaaaattcttcaggtattaacgttctgccaatt
atagaaataattactcctgataataggtgttacgactatgaaagtaaatatttttccaaa
gaaactaagtatttatgtcctgctaagttacctttagagctaaataatgatcttataaag
atatgtaaaaaagcttatgaagtgattcattgtaaaggttgggctagaatagatattatt
ttggataaatttaacaaagcatggttattagaaattaatacctgccctggtatgactata
aattcactcatgccaattgcagcaagagcgaatggaattaattatgaagacttatgtttg
agcatattatcaatggcttcatttaagaagtaa

DBGET integrated database retrieval system